Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00030 GAP43 Homo sapiens Yes Kinases; Membrane Proteins

HuProt v2.0
Block Row Column Clone
2 1 15 JHU00030
2 1 16 JHU00030
HuProt v3.0
Block Row Column Clone
1 3 3 JHU00030
1 4 3 JHU00030
HuProt v3.1
Block Row Column Clone
1 3 3 JHU00030
1 4 3 JHU00030

External Database ID

Nucleotide (717bp)

>JHU00030
ATGCTGTGCTGTATGAGAAGAACCAAACAGGTTGAAAAAAATGATGACGACCAAAAGATTGAACAAGATGGTATCAAACC
AGAAGATAAAGCTCATAAGGCCGCAACCAAAATTCAGGCTAGCTTCCGTGGACACATAACAAGGAAAAAGCTCAAAGGAG
AGAAGAAGGATGATGTCCAAGCTGCTGAGGCTGAAGCTAATAAGAAGGATGAAGCCCCTGTTGCCGATGGGGTGGAGAAG
AAGGGAGAAGGCACCACTACTGCCGAAGCAGCCCCAGCCACTGGCTCCAAGCCTGATGAGCCCGGCAAAGCAGGAGAAAC
TCCTTCCGAGGAGAAGAAGGGGGAGGGTGATGCTGCCACAGAGCAGGCAGCCCCCCAGGCTCCTGCATCCTCAGAGGAGA
AGGCCGGCTCAGCTGAGACAGAAAGTGCCACTAAAGCTTCCACTGATAACTCGCCGTCCTCCAAGGCTGAAGATGCCCCA
GCCAAGGAGGAGCCTAAACAAGCCGATGTGCCTGCTGCTGTCACTGCTGCTGCTGCCACCACCCCTGCCGCAGAGGATGC
TGCTGCCAAGGCAACAGCCCAGCCTCCAACGGAGACTGGGGAGAGCAGCCAAGCTGAAGAGAACATAGAAGCTGTAGATG
AAACCAAACCTAAGGAAAGTGCCCGGCAGGACGAGGGTAAAGAAGAGGAACCTGAGGCTGACCAAGAACATGCCTAG

Protein (238aa)

>JHU00030
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEK
KGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAP
AKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA