Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00003 AAK1 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
20 1 13 JHU00003
20 1 14 JHU00003
HuProt v3.0
Block Row Column Clone
1 1 20 JHU00003
1 2 20 JHU00003
HuProt v3.1
Block Row Column Clone
1 1 20 JHU00003
1 2 20 JHU00003

External Database ID

Nucleotide (1425bp)

>JHU00003
ATGAAGAAGTTTTTCGACTCCCGGCGAGAGCAGGGCGGCTCTGGCCTGGGCTCCGGCTCCAGCGGAGGAGGGGGCAGCAC
CTCGGGCCTGGGCAGTGGCTACATCGGAAGAGTCTTCGGCATCGGGCGACAGCAGGTCACAGTGGACGAGGTGTTGGCGG
AAGGTGGATTTGCTATTGTATTTCTGGTGAGGACAAGCAATGGGATGAAATGTGCCTTGAAACGCATGTTTGTCAACAAT
GAGCATGATCTCCAGGTGTGCAAGAGAGAAATCCAGATAATGAGGGATCTTTCAGGGCACAAGAATATTGTGGGTTACAT
TGATTCTAGTATCAACAACGTGAGTAGCGGTGATGTATGGGAAGTGCTCATTCTGATGGACTTTTGTAGAGGTGGCCAGG
TGGTAAACCTGATGAACCAGCGCCTGCAAACAGGCTTTACAGAGAATGAAGTGCTCCAGATATTTTGTGATACCTGTGAA
GCTGTTGCCCGCCTGCATCAGTGCAAAACTCCTATTATCCACCGGGACCTGAAGGTTGAAAACATCCTCTTGCATGACCG
AGGCCACTATGTCCTGTGTGACTTTGGAAGCGCCACCAACAAATTCCAGAATCCACAAACTGAGGGAGTCAATGCAGTAG
AAGATGAGATTAAGAAATACACAACGCTGTCCTATCGAGCACCAGAAATGGTCAACCTGTACAGTGGCAAAATCATCACT
ACGAAGGCAGACATTTGGGCTCTTGGATGTTTGTTGTATAAATTATGCTACTTCACTTTGCCATTTGGGGAAAGTCAGGT
GGCAATTTGTGATGGAAACTTCACAATTCCTGATAATTCTCGATATTCTCAAGACATGCACTGCCTAATTAGGTATATGT
TGGAACCAGACCCTGACAAAAGGCCGGATATTTACCAGGTGTCCTACTTCTCATTTAAGCTACTCAAGAAAGAGTGCCCA
ATTCCAAATGTACAGAACTCTCCCATTCCTGCAAAGCTTCCTGAACCAGTGAAAGCCAGTGAGGCAGCTGCAAAAAAGAC
CCAGCCAAAGGCCAGACTGACAGATCCCATTCCCACCACAGAGACTTCAATTGCACCCCGCCAGAGGCCTAAAGCTGGGC
AGACTCAGCCGAACCCAGGAATCCTTCCCATCCAGCCAGCGCTGACACCCCGGAAGAGGGCCACTGTTCAGCCCCCACCT
CAGGCTGCAGGATCCAGCAATCAGCCTGGCCTTTTAGCCAGTGTTCCCCAACCAAAACCCCAAGCCCCACCCAGCCAGCC
TCTGCCGCAAACTCAGGCCAAGCAGCCACAGGCTCCTCCCACTCCACAGCAGACGCCTTCTACTCAGGCCCAGGGTCTGC
CCGCTCAGGCCCAGGCCACACCCCAGCACCAGCAGCATACAATAAAACTTAGTATGAAACTTTAG

Protein (474aa)

>JHU00003
MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNN
EHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCE
AVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIIT
TKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECP
IPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTTETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPP
QAAGSSNQPGLLASVPQPKPQAPPSQPLPQTQAKQPQAPPTPQQTPSTQAQGLPAQAQATPQHQQHTIKLSMKL