Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00293 GPN3 ATPBD1C Homo sapiens Yes Secreted Proteins

HuProt v2.0
Block Row Column Clone
5 1 9 JHU00293
5 1 10 JHU00293
HuProt v3.0
Block Row Column Clone
2 1 7 JHU00293
2 2 7 JHU00293
HuProt v3.1
Block Row Column Clone
2 1 7 JHU00293
2 2 7 JHU00293

External Database ID

Nucleotide (855bp)

>JHU00293
ATGCCTCGGTATGCGCAGCTGGTCATGGGCCCCGCGGGCAGCGGGAAGAGCACCTACTGTGCCACCATGGTCCAGCACTG
TGAAGCCCTCAACCGGTCTGTCCAAGTTGTAAACCTGGATCCAGCAGCAGAACACTTCAACTACTCCGTGATGGCTGACA
TCCGGGAACTGATCGAGGTGGATGATGTAATGGAGGATGATTCTCTGCGATTCGGTCCCAACGGAGGATTGGTATTTTGC
ATGGAGTACTTTGCCAATAATTTTGACTGGCTGGAGAACTGTCTTGGCCATGTAGAGGACGACTATATCCTTTTTGATTG
TCCAGGTCAGATTGAGTTGTACACTCACCTGCCTGTGATGAAACAGCTGGTCCAGCAGCTCGAGCAGTGGGAGTTCCGAG
TCTGTGGAGTTTTTCTTGTTGATTCTCAGTTCATGGTGGAGTCATTCAAGTTTATTTCTGGCATCTTGGCAGCCCTGAGT
GCCATGATCTCTCTAGAAATTCCGCAAGTCAACATCATGACAAAAATGGATCTGCTGAGTAAAAAAGCAAAAAAGGAAAT
TGAGAAATTTTTAGATCCAGACATGTATTCTTTATTAGAAGATTCTACAAGTGACTTAAGAAGCAAAAAATTCAAGAAAC
TGACTAAAGCTATATGTGGACTGATTGATGACTACAGCATGGTTCGATTTTTACCTTACGATCAGTCAGATGAAGAAAGC
ATGAACATTGCATTGCAGCATATTGATTTTGCCATTCAATATGGAGAAGACCTAGAATTTAAAGAACCAAAGGAACGTGA
AGATGAGTCTTCCTCTATGTTTGACGAATATTTTCAAGAATGCCAGGATGAATAG

Protein (284aa)

>JHU00293
MPRYAQLVMGPAGSGKSTYCATMVQHCEALNRSVQVVNLDPAAEHFNYSVMADIRELIEVDDVMEDDSLRFGPNGGLVFC
MEYFANNFDWLENCLGHVEDDYILFDCPGQIELYTHLPVMKQLVQQLEQWEFRVCGVFLVDSQFMVESFKFISGILAALS
AMISLEIPQVNIMTKMDLLSKKAKKEIEKFLDPDMYSLLEDSTSDLRSKKFKKLTKAICGLIDDYSMVRFLPYDQSDEES
MNIALQHIDFAIQYGEDLEFKEPKEREDESSSMFDEYFQECQDE