Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00029 GALK2 GK2 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
26 1 9 JHU00029
26 1 10 JHU00029
HuProt v3.0
Block Row Column Clone
2 1 23 JHU00029
2 2 23 JHU00029
HuProt v3.1
Block Row Column Clone
2 1 23 JHU00029
2 2 23 JHU00029

External Database ID

Nucleotide (1377bp)

>JHU00029
ATGGCTACAGAGAGCCCTGCTACGCGTCGGGTCCAGGTGGCAGAACATCCTAGGTTACTGAAGCTAAAGGAGATGTTTAA
CTCCAAGTTTGGATCTATTCCCAAGTTTTATGTTCGAGCACCAGGAAGAGTCAACATAATAGGAGAGCATATAGATTATT
GTGGATATTCTGTTCTTCCTATGGCTGTAGAACAAGATGTGCTAATAGCTGTAGAACCTGTGAAAACGTACGCTCTCCAA
CTGGCCAATACAAATCCCTTGTATCCGGACTTCAGTACTAGTGCTAATAACATCCAGATTGATAAAACCAAGCCTTTGTG
GCACAACTATTTCTTATGTGGACTTAAAGGAATTCAGGAACACTTTGGTCTTAGTAACCTGACTGGAATGAACTGCCTGG
TAGATGGAAATATCCCACCAAGTTCTGGCCTCTCCAGCTCCAGTGCTTTGGTCTGTTGTGCTGGCTTGGTGACGCTCACA
GTGCTGGGAAGGAATCTATCCAAGGTGGAACTTGCAGAAATCTGTGCCAAGAGTGAGCGTTACATTGGCACTGAAGGAGG
AGGCATGGACCAGTCTATATCATTTCTTGCAGAAGAAGGAACTGCCAAGTTGATAGAATTTAGTCCTCTGAGGGCAACCG
ATGTAAAACTCCCAAGTGGAGCAGTGTTTGTGATTGCCAACAGTTGTGTGGAGATGAATAAGGCAGCAACTTCCCATTTC
AATATCAGGGTGATGGAGTGTCGGCTGGCTGCGAAGCTCCTGGCTAAATACAAAAGCTTGCAATGGGACAAAGTACTGAG
GCTGGAGGAGGTGCAGGCTAAACTAGGGATTAGTCTAGAAGAAATGCTGTTGGTCACAGAAGATGCCCTTCATCCTGAAC
CCTATAACCCTGAGGAGATCTGCAGGTGTCTGGGAATTAGCCTGGAGGAACTCCGAACCCAAATCCTGAGTCCAAACACT
CAAGATGTGCTCATCTTCAAACTCTATCAGCGGGCAAAGCATGTGTACAGCGAGGCTGCGCGAGTGCTCCAGTTTAAGAA
GATATGTGAAGAAGCACCTGAAAACATGGTCCAGCTGCTGGGAGAGTTGATGAACCAGAGCCACATGAGCTGCCGGGACA
TGTATGAGTGCAGCTGCCCCGAGCTGGATCAGCTGGTGGACATCTGTCGGAAGTTTGGGGCTCAAGGGTCACGACTTACT
GGAGCAGGATGGGGAGGCTGTACAGTATCAATGGTACCTGCGGACAAGCTGCCCAGCTTTCTAGCAAATGTGCACAAAGC
TTATTACCAGAGGAGTGATGGAAGCTTAGCACCGGAGAAGCAAAGTTTGTTTGCTACCAAACCTGGAGGTGGGGCTTTGG
TTTTGCTTGAGGCCTAG

Protein (458aa)

>JHU00029
MATESPATRRVQVAEHPRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIAVEPVKTYALQ
LANTNPLYPDFSTSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGMNCLVDGNIPPSSGLSSSSALVCCAGLVTLT
VLGRNLSKVELAEICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGAVFVIANSCVEMNKAATSHF
NIRVMECRLAAKLLAKYKSLQWDKVLRLEEVQAKLGISLEEMLLVTEDALHPEPYNPEEICRCLGISLEELRTQILSPNT
QDVLIFKLYQRAKHVYSEAARVLQFKKICEEAPENMVQLLGELMNQSHMSCRDMYECSCPELDQLVDICRKFGAQGSRLT
GAGWGGCTVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLEA