Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00289 ABI1 SSH3BP1 Homo sapiens Yes Kinases; Membrane Proteins; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
31 1 5 JHU00289
31 1 6 JHU00289
31 1 25 JHU00289
31 1 26 JHU00289
HuProt v3.0
Block Row Column Clone
3 1 28 JHU00289
3 2 28 JHU00289
2 7 28 JHU00289
2 8 28 JHU00289
HuProt v3.1
Block Row Column Clone
3 1 28 JHU00289
3 2 28 JHU00289
2 7 28 JHU00289
2 8 28 JHU00289

External Database ID

Nucleotide (1431bp)

>JHU00289
ATGGCAGAGCTGCAGATGTTACTAGAGGAGGAGATCCCGTCTGGCAAGAGGGCGCTGATCGAGAGTTACCAGAACCTGAC
TCGGGTGGCAGACTACTGTGAAAACAACTACATACAGGCTACAGACAAGAGAAAAGCTTTAGAGGAGACCAAAGCCTATA
CAACCCAATCTCTAGCTAGTGTTGCTTATCAAATAAATGCATTGGCCAACAATGTACTCCAGTTGCTGGATATCCAAGCC
TCTCAGCTTCGGAGAATGGAGTCTTCCATCAATCATATCTCACAGACTGTGGATATTCATAAGGAGAAAGTGGCACGAAG
AGAGATTGGTATTTTGACAACAAATAAGAATACATCAAGAACTCACAAAATAATAGCACCTGCGAATATGGAGCGCCCTG
TAAGGTATATTCGGAAACCTATCGATTACACAGTTCTGGATGATGTGGGCCATGGTGTCAAGCATGGAAATAACCAGCCT
GCAAGAACTGGCACACTGTCGAGAACAAATCCTCCTACTCAGAAACCGCCAAGTCCTCCCATGTCAGGCCGGGGAACACT
GGGACGGAATACTCCTTATAAAACCCTGGAACCTGTTAAACCCCCAACAGTTCCTAATGACTATATGACCAGTCCTGCTA
GGCTTGGAAGTCAGCATAGTCCAGGCAGGACAGCATCTTTAAATCAGAGACCAAGGACACACAGTGGAAGTAGTGGAGGA
AGTGGAAGTCGAGAAAACAGTGGTAGCAGTAGTATTGGCATTCCCATTGCTGTGCCTACACCTTCGCCACCCACTATTGG
ACCAGCAGCCCCGGGCTCAGCTCCTGGTTCCCAGTATGGCACAATGACCAGGCAGATATCTCGACACAACTCTACTACTT
CTTCGACATCTTCTGGTGGATACAGACGAACTCCCTCTGTGACTGCTCAATTTTCTGCTCAGCCTCATGTTAATGGAGGT
CCACTTTATTCTCAAAATTCAATTTCTATTGCTCCACCCCCTCCCCCTATGCCTCAGTTGACTCCACAGATACCTCTCAC
AGGCTTCGTGGCCAGGGTGCAGGAAAACATTGCTGATAGTCCAACTCCACCGCCACCACCTCCACCAGATGACATTCCCA
TGTTTGATGACTCTCCACCTCCCCCACCACCACCACCAGTGGATTATGAAGATGAGGAGGCTGCAGTAGTTCAGTATAAT
GATCCATATGCAGATGGGGATCCTGCTTGGGCCCCCAAGAATTATATTGAGAAAGTTGTTGCAATATATGATTATACAAA
AGACAAGGATGATGAGCTGTCATTTATGGAGGGTGCAATCATTTATGTTATAAAGAAGAATGATGATGGCTGGTATGAAG
GAGTCTGCAATCGAGTGACTGGTCTGTTCCCTGGGAACTATGTTGAATCAATCATGCACTATACTGATTAG

Protein (476aa)

>JHU00289
MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALANNVLQLLDIQA
SQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKHGNNQP
ARTGTLSRTNPPTQKPPSPPMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSSGG
SGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGG
PLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVDYEDEEAAVVQYN
DPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDDGWYEGVCNRVTGLFPGNYVESIMHYTD