Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00280 RRAS2 TC21 Homo sapiens Yes Cell Death; Kinases; Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
25 1 5 JHU00280
25 1 6 JHU00280
HuProt v3.0
Block Row Column Clone
3 1 25 JHU00280
3 2 25 JHU00280
HuProt v3.1
Block Row Column Clone
3 1 25 JHU00280
3 2 25 JHU00280

External Database ID

Nucleotide (615bp)

>JHU00280
ATGGCCGCGGCCGGCTGGCGGGACGGCTCCGGCCAGGAGAAGTACCGGCTCGTGGTGGTCGGCGGGGGCGGCGTGGGCAA
GTCGGCGCTCACCATCCAGTTCATCCAGTCCTATTTTGTAACGGATTACGATCCAACCATTGAAGATTCTTACACAAAGC
AGTGTGTGATAGATGACAGAGCAGCCCGGCTAGATATTTTGGATACAGCAGGACAAGAAGAGTTTGGAGCCATGAGAGAA
CAGTATATGAGGACTGGCGAAGGCTTCCTGTTGGTCTTTTCAGTCACAGATAGAGGCAGTTTTGAAGAAATCTATAAGTT
TCAAAGACAGATTCTCAGAGTAAAGGATCGTGATGAGTTCCCAATGATTTTAATTGGTAATAAAGCAGATCTGGATCATC
AAAGACAGGTAACACAGGAAGAAGGACAACAGTTAGCACGGCAGCTTAAGGTAACATACATGGAGGCATCAGCAAAGATT
AGGATGAATGTAGATCAAGCTTTCCATGAACTTGTCCGGGTTATCAGGAAATTTCAAGAGCAGGAATGTCCTCCTTCACC
AGAACCAACACGGAAAGAAAAAGACAAGAAAGGCTGCCATTGTGTCATTTTCTAG

Protein (204aa)

>JHU00280
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMRE
QYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKI
RMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF