Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00278 RRAGD Homo sapiens Yes Metabolism; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
1 1 9 JHU00278
1 1 10 JHU00278
28 23 1 JHU00278
28 23 2 JHU00278
HuProt v3.0
Block Row Column Clone
2 1 1 JHU00278
2 2 1 JHU00278
20 25 26 JHU00278
20 26 26 JHU00278
HuProt v3.1
Block Row Column Clone
2 1 1 JHU00278
2 2 1 JHU00278
20 25 26 JHU00278
20 26 26 JHU00278

External Database ID

Nucleotide (750bp)

>JHU00278
ATGGAAGCCCTGGCCAGGCTCCACCTCACGGTGACCAGGGCCTACAAAGTGAATACTGACATCAACTTCGAGGTGTTTAT
TCATAAAGTGGATGGTCTGTCAGATGACCACAAAATTGAAACCCAAAGAGATATTCACCAGAGGGCAAACGATGACCTTG
CAGATGCTGGATTAGAAAAAATTCACCTCAGCTTTTATCTGACAAGCATATATGATCATTCAATATTTGAAGCTTTTAGC
AAAGTTGTTCAGAAACTGATTCCACAACTCCCAACTCTGGAGAATTTGCTGAACATCTTTATCTCAAATTCTGGAATTGA
AAAGGCATTTCTATTTGATGTGGTCAGTAAAATTTATATTGCAACTGATAGTACTCCGGTGGATATGCAAACCTATGAGC
TCTGCTGTGATATGATAGATGTGGTTATTGACATCTCTTGTATTTATGGTCTCAAAGAAGATGGAGCAGGAACCCCCTAT
GACAAGGAATCCACAGCCATCATAAAGCTTAATAATACAACCGTGCTTTATTTAAAAGAGGTGACAAAGTTCCTGGCTCT
CGTTTGCTTTGTCAGAGAGGAAAGCTTTGAAAGAAAAGGGCTAATTGACTATAATTTTCATTGCTTCCGGAAGGCCATTC
ATGAAGTTTTTGAGGTGAGAATGAAAGTAGTAAAATCTCGAAAGGTTCAGAATCGGCTGCAGAAGAAAAAGAGAGCCACC
CCTAATGGGACCCCTAGAGTGCTGCTGTAG

Protein (249aa)

>JHU00278
MEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSFYLTSIYDHSIFEAFS
KVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDMQTYELCCDMIDVVIDISCIYGLKEDGAGTPY
DKESTAIIKLNNTTVLYLKEVTKFLALVCFVREESFERKGLIDYNFHCFRKAIHEVFEVRMKVVKSRKVQNRLQKKKRAT
PNGTPRVLL