Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00277 RRAGA Homo sapiens Yes Cell Death; Metabolism; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
9 1 5 JHU00277
9 1 6 JHU00277
HuProt v3.0
Block Row Column Clone
3 1 11 JHU00277
3 2 11 JHU00277
HuProt v3.1
Block Row Column Clone
3 1 11 JHU00277
3 2 11 JHU00277
24 37 6 JHU00277
24 38 6 JHU00277

External Database ID

Nucleotide (942bp)

>JHU00277
ATGCCAAATACAGCCATGAAGAAAAAGGTGCTGCTGATGGGGAAGAGCGGGTCGGGGAAGACCAGCATGAGGTCGATAAT
CTTCGCCAATTACATTGCTCGCGACACCCGGCGCCTGGGGGCCACCATTGACGTGGAACACTCCCACGTCCGATTCCTAG
GGAACCTGGTGCTGAACCTGTGGGACTGTGGCGGTCAGGACACCTTCATGGAAAATTACTTCACCAGCCAGCGAGACAAT
ATCTTCCGTAACGTGGAAGTTTTGATTTACGTGTTTGACGTGGAGAGCCGCGAACTGGAAAAGGACATGCATTATTACCA
GTCGTGTCTGGAGGCCATCCTCCAGAACTCTCCTGACGCCAAAATCTTCTGCCTGGTGCACAAAATGGATCTGGTTCAGG
AGGATCAGCGTGACCTGATTTTTAAAGAGCGAGAGGAAGACCTGAGGCGTCTGTCTCGCCCGCTGGAGTGTGCTTGTTTT
CGAACGTCCATCTGGGATGAGACGCTCTACAAAGCCTGGTCCAGCATCGTCTACCAGCTGATTCCCAACGTTCAGCAGCT
GGAGATGAACCTCAGGAATTTTGCCCAAATCATTGAGGCCGATGAAGTTCTGCTGTTCGAAAGAGCTACATTCTTGGTTA
TTTCCCACTACCAGTGCAAAGAGCAGCGCGACGTCCACCGGTTTGAGAAGATCAGCAACATCATCAAACAGTTCAAGCTG
AGCTGCAGTAAATTGGCCGCTTCCTTCCAGAGCATGGAAGTTAGGAATTCCAACTTCGCTGCTTTCATCGACATCTTCAC
CTCAAATACGTACGTGATGGTGGTCATGTCAGATCCGTCGATCCCTTCTGCGGCCACTCTGATCAACATTCGCAATGCCC
GGAAACACTTTGAGAAGCTGGAGAGAGTGGATGGCCCCAAGCACAGTCTCCTTATGCGTTAG

Protein (313aa)

>JHU00277
MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDN
IFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACF
RTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKL
SCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLLMR