Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00274 RHOA ARH12;ARHA;RHO12 Homo sapiens Yes Kinases; Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
11 1 13 JHU00274
11 1 14 JHU00274
HuProt v3.0
Block Row Column Clone
1 1 16 JHU00274
1 2 16 JHU00274
HuProt v3.1
Block Row Column Clone
1 1 16 JHU00274
1 2 16 JHU00274

External Database ID

Nucleotide (582bp)

>JHU00274
ATGGCTGCCATCCGGAAGAAACTGGTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAGTCTTCAGCAA
GGACCAGTTCCCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTGGATGGAAAGCAGGTAG
AATTGGCTTTGTGGGACACAGCTGGGCAGGAAGATTATGATCGCCTGAGGCCCCTCTCCTACCCAGATACCGATGTTATA
CTGATGTGTTTTTCCATCGACAGCCCTGATAGTTTAGAAAACATCCCAGAAAAGTGGACCCCAGAAGTCAAGCATTTCTG
TCCCAACGTGCCCATCATCCTGGTTGGGAATAAGAAGGATCTTCGGAATGATGAGCACACAAGGCGGGAGCTAGCCAAGA
TGAAGCAGGAGCCGGTGAAACCTGAAGAAGGCAGAGATATGGCAAACAGGATTGGCGCTTTTGGGTACATGGAGTGTTCA
GCAAAGACCAAAGATGGAGTGAGAGAGGTTTTTGAAATGGCTACGAGAGCTGCTCTGCAAGCTAGACGTGGGAAGAAAAA
ATCTGGGTGCCTTGTCTTGTAG

Protein (193aa)

>JHU00274
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVI
LMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECS
AKTKDGVREVFEMATRAALQARRGKKKSGCLVL