Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00271 RASL11B Homo sapiens Yes Signal Transduction

HuProt v2.0
Block Row Column Clone
9 1 1 JHU00271
9 1 2 JHU00271
4 24 19 JHU00271
4 24 20 JHU00271
HuProt v3.0
Block Row Column Clone
4 1 11 JHU00271
4 2 11 JHU00271
20 45 20 JHU00271
20 46 20 JHU00271
HuProt v3.1
Block Row Column Clone
4 1 11 JHU00271
4 2 11 JHU00271
20 45 20 JHU00271
20 46 20 JHU00271

External Database ID

Nucleotide (747bp)

>JHU00271
ATGCGCCTCATTCAGAACATGTGCACCATCGCCGAGTACCCCGCGCCGGGCAACGCCGCGGCCTCCGACTGCTGTGTGGG
CGCCGCCGGCCGCCGCCTGGTCAAGATCGCCGTGGTGGGCGCCAGCGGCGTGGGCAAGACCGCACTGGTGGTCCGGTTCC
TCACCAAACGATTCATCGGTGACTATGAAAGAAATGCAGGTAATCTCTATACTAGACAAGTTCAGATAGAAGGTGAAACC
CTGGCTCTTCAGGTTCAAGACACTCCAGGTATTCAGGTCCATGAGAACAGCCTGAGCTGCAGTGAACAGCTGAATAGGTG
CATTCGCTGGGCAGATGCTGTGGTGATCGTTTTCTCCATCACTGACTACAAGAGCTATGAACTCATCAGCCAGCTCCACC
AGCACGTGCAGCAGCTACACCTGGGCACCCGGCTGCCTGTGGTGGTCGTGGCCAACAAAGCTGACCTGTTGCACATCAAA
CAGGTTGACCCTCAGCTTGGACTGCAGCTAGCCAGCATGCTAGGCTGCTCATTCTATGAAGTGTCTGTCAGTGAAAATTA
TAATGATGTCTACAGCGCCTTCCACGTCCTCTGTAAAGAGGTCAGTCACAAACAGCAGCCTAGCAGTACACCCGAGAAGC
GAAGAACCTCCCTCATTCCCAGGCCCAAGTCACCCAACATGCAGGACCTGAAGAGGAGGTTTAAGCAAGCCCTCTCTGCC
AAAGTGAGGACTGTCACCTCCGTCTAG

Protein (248aa)

>JHU00271
MRLIQNMCTIAEYPAPGNAAASDCCVGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLYTRQVQIEGET
LALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQLHQHVQQLHLGTRLPVVVVANKADLLHIK
QVDPQLGLQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPRPKSPNMQDLKRRFKQALSA
KVRTVTSV