Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00270 RASGEF1A Homo sapiens Yes Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
27 1 9 JHU00270
27 1 10 JHU00270
HuProt v3.0
Block Row Column Clone
2 1 24 JHU00270
2 2 24 JHU00270
HuProt v3.1
Block Row Column Clone
2 1 24 JHU00270
2 2 24 JHU00270

External Database ID

Nucleotide (1287bp)

>JHU00270
ATGGAGCACCTTGTTCCCACGGTGGACTATTACCCCGATAGGACGTACATCTTCACCTTTCTCCTGAGCTCCCGGGTCTT
TATGCCCCCTCATGACCTGCTGGCCCGCGTGGGGCAGATCTGCGTGGAGCAGAAGCAGCAGCTGGAAGCCGGGCCTGAAA
AGGCCAAGCTGAAGTCTTTCTCAGCCAAGATCGTGCAGCTCCTGAAGGAGTGGACCGAGGCCTTCCCCTATGACTTCCAG
GATGAGAAGGCCATGGCCGAGCTGAAAGCCATCACACACCGTGTCACCCAGTGTGATGAGGAGAATGGCACAGTGAAGAA
GGCCATTGCCCAGATGACACAGAGCCTGTTGCTGTCCTTGGCTGCCCGGAGCCAGCTCCAGGAACTGCGAGAGAAGCTCC
GGCCACCGGCTGTAGACAAGGGGCCCATCCTCAAGACCAAGCCACCAGCCGCCCAGAAGGACATCCTGGGCGTGTGCTGC
GACCCCCTGGTGCTGGCCCAGCAGCTGACTCACATTGAGCTGGACAGGGTCAGCAGCATTTACCCTGAGGACTTGATGCA
GATCGTCAGCCACATGGACTCATTGGACAACCACAGGTGCCGAGGGGACCTGACCAAGACCTACAGCCTGGAGGCCTATG
ACAACTGGTTCAACTGCCTGAGCATGCTGGTGGCCACTGAGGTGTGCCGGGTGGTGAAGAAGAAACACCGGACCCGCATG
TTGGAGTTCTTCATTGATGTGGCCCGGGAGTGCTTCAACATCGGGAACTTCAACTCCATGATGGCCATCATCTCTGGCAT
GAACCTCAGTCCTGTGGCAAGGCTGAAGAAAACTTGGTCCAAGGTCAAGACAGCCAAGTTTGATGTCTTGGAGCATCACA
TGGACCCGTCCAGCAACTTCTGCAACTACCGTACAGCCCTGCAGGGGGCCACGCAGAGGTCCCAGATGGCCAACAGCAGC
CGTGAAAAGATCGTCATCCCTGTGTTCAACCTCTTCGTTAAGGACATCTACTTCCTGCACAAAATCCATACCAACCACCT
GCCCAACGGGCACATTAACTTTAAGAAATTCTGGGAGATCTCCAGACAGATCCATGAGTTCATGACATGGACACAGGTAG
AGTGTCCTTTCGAGAAGGACAAGAAGATTCAGAGTTACCTGCTCACGGCGCCCATCTACAGCGAGGAAGCTCTCTTCGTC
GCCTCCTTTGAAAGTGAGGGTCCCGAGAACCACGTGGAAAAAGACAGCTGGAAGACCCTCAGGACCACCCTTCTGAACAG
AGCCTAG

Protein (428aa)

>JHU00270
MEHLVPTVDYYPDRTYIFTFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLLKEWTEAFPYDFQ
DEKAMAELKAITHRVTQCDEENGTVKKAIAQMTQSLLLSLAARSQLQELREKLRPPAVDKGPILKTKPPAAQKDILGVCC
DPLVLAQQLTHIELDRVSSIYPEDLMQIVSHMDSLDNHRCRGDLTKTYSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRM
LEFFIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKVKTAKFDVLEHHMDPSSNFCNYRTALQGATQRSQMANSS
REKIVIPVFNLFVKDIYFLHKIHTNHLPNGHINFKKFWEISRQIHEFMTWTQVECPFEKDKKIQSYLLTAPIYSEEALFV
ASFESEGPENHVEKDSWKTLRTTLLNRA