Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00269 RASD2 TEM2 Homo sapiens Yes Kinases; Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
25 1 9 JHU00269
25 1 10 JHU00269
HuProt v3.0
Block Row Column Clone
2 1 25 JHU00269
2 2 25 JHU00269
HuProt v3.1
Block Row Column Clone
2 1 25 JHU00269
2 2 25 JHU00269

External Database ID

Nucleotide (801bp)

>JHU00269
ATGATGAAGACTTTGTCCAGCGGGAACTGCACGCTCAGTGTGCCCGCCAAAAACTCATACCGCATGGTGGTGCTGGGTGC
CTCTCGGGTGGGCAAGAGCTCCATCGTGTCTCGCTTCCTCAATGGCCGCTTTGAGGACCAGTACACACCCACCATCGAGG
ACTTCCACCGTAAGGTATACAACATCCGCGGCGACATGTACCAGCTCGACATCCTGGATACCTCTGGCAACCACCCCTTC
CCCGCCATGCGCAGGCTGTCCATCCTCACAGGGGATGTCTTCATCCTGGTGTTCAGCCTGGATAACCGGGAGTCCTTCGA
TGAGGTCAAGCGCCTTCAGAAGCAGATCCTGGAGGTCAAGTCCTGCCTGAAGAACAAGACCAAGGAGGCGGCGGAGCTGC
CCATGGTCATCTGTGGCAACAAGAACGACCACGGCGAGCTGTGCCGCCAGGTGCCCACCACCGAGGCCGAGCTGCTGGTG
TCGGGCGACGAGAACTGCGCCTACTTCGAGGTGTCGGCCAAGAAGAACACCAACGTGGACGAGATGTTCTACGTGCTCTT
CAGCATGGCCAAGCTGCCACACGAGATGAGCCCCGCCCTGCATCGCAAGATCTCCGTGCAGTACGGTGACGCCTTCCACC
CCAGGCCCTTCTGCATGCGCCGCGTCAAGGAGATGGACGCCTATGGCATGGTCTCGCCCTTCGCCCGCCGCCCCAGCGTC
AACAGTGACCTCAAGTACATCAAGGCCAAGGTCCTTCGGGAAGGCCAGGCCCGTGAGAGGGACAAGTGCACCATCCAGTA
G

Protein (266aa)

>JHU00269
MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPF
PAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLV
SGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSV
NSDLKYIKAKVLREGQARERDKCTIQ