Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00266 RAC1 TC25 Homo sapiens Yes Cell Death; Kinases; Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
3 1 5 JHU00266
3 1 6 JHU00266
HuProt v3.0
Block Row Column Clone
3 1 6 JHU00266
3 2 6 JHU00266
HuProt v3.1
Block Row Column Clone
3 1 6 JHU00266
3 2 6 JHU00266

External Database ID

Nucleotide (579bp)

>JHU00266
ATGCAGGCCATCAAGTGTGTGGTGGTGGGAGACGGAGCTGTAGGTAAAACTTGCCTACTGATCAGTTACACAACCAATGC
ATTTCCTGGAGAATATATCCCTACTGTCTTTGACAATTATTCTGCCAATGTTATGGTAGATGGAAAACCGGTGAATCTGG
GCTTATGGGATACAGCTGGACAAGAAGATTATGACAGATTACGCCCCCTATCCTATCCGCAAACAGATGTGTTCTTAATT
TGCTTTTCCCTTGTGAGTCCTGCATCATTTGAAAATGTCCGTGCAAAGTGGTATCCTGAGGTGCGGCACCACTGTCCCAA
CACTCCCATCATCCTAGTGGGAACTAAACTTGATCTTAGGGATGATAAAGACACGATCGAGAAACTGAAGGAGAAGAAGC
TGATTCCCATCACCTATCCGCAGGGTCTAGCCATGGCTAAGGAGATTGGTGCTGTAAAATACCTGGAGTGCTCGGCGCTC
ACACAGCGAGGCCTCAAGACAGTGTTTGACGAAGCGATCCGAGCAGTCCTCTGCCCGCCTCCCGTGAAGAAGAGGAAGAG
AAAATGCCTGCTGTTGTAG

Protein (192aa)

>JHU00266
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLI
CFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLIPITYPQGLAMAKEIGAVKYLECSAL
TQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL