Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00265 IFT22 RABL5 Homo sapiens Yes Signal Transduction

HuProt v2.0
Block Row Column Clone
1 1 1 JHU00265
1 1 2 JHU00265
5 1 5 JHU00265
5 1 6 JHU00265
HuProt v3.0
Block Row Column Clone
4 1 1 JHU00265
4 2 1 JHU00265
3 1 7 JHU00265
3 2 7 JHU00265
HuProt v3.1
Block Row Column Clone
4 1 1 JHU00265
4 2 1 JHU00265
3 1 7 JHU00265
3 2 7 JHU00265

External Database ID

Nucleotide (468bp)

>JHU00265
ATGCTGAAAGCCAAGATCCTCTTCGTGGGGCCTTGCGAGAGTGGAAAAACTGTTTTGGCCAACTTTCTGACAGAATCTTC
TGACATCACTGAATACAGCCCAACCCAAGGAGTGAGGTTTGAGTCCTGCTGGCCGGCCCTGATGAAGGATGCTCATGGAG
TGGTGATCGTCTTCAATGCTGACATCCCAAGCCACCGGAAGGAAATGGAGATGTGGTATTCCTGCTTTGTCCAACAGCCG
TCCTTACAGGACACACAGTGTATGCTAATTGCACACCACAAACCAGGCTCTGGAGATGATAAAGGAAGCCTGTCTTTGTC
GCCACCCTTGAACAAGCTGAAGCTGGTGCACTCAAACCTGGAAGATGACCCTGAGGAGATCCGGATGGAATTCATAAAGT
ATTTAAAAAGCATAATCAACTCCATGTCTGAGAGCAGAGACAGGGAGGAGATGTCAATTATGACCTAG

Protein (155aa)

>JHU00265
MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRFESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQP
SLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMT