Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00258 RAB3D GOV;RAB16 Homo sapiens Yes Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
17 1 13 JHU00258
17 1 14 JHU00258
HuProt v3.0
Block Row Column Clone
1 1 19 JHU00258
1 2 19 JHU00258
HuProt v3.1
Block Row Column Clone
1 1 19 JHU00258
1 2 19 JHU00258
21 45 24 JHU00258
21 46 24 JHU00258

External Database ID

Nucleotide (660bp)

>JHU00258
ATGGCATCAGCTGGAGACACCCAGGCAGGCCCACGGGATGCAGCAGATCAGAACTTCGACTATATGTTCAAACTGCTACT
GATAGGCAACAGCAGTGTGGGCAAGACTTCCTTCCTGTTCCGATACGCGGACGACTCCTTCACTCCCGCCTTCGTCAGTA
CTGTGGGCATCGATTTCAAGGTCAAGACCGTCTACCGCCATGACAAGAGGATCAAGCTGCAGATCTGGGACACAGCGGGC
CAGGAGCGCTACCGCACCATCACCACGGCCTACTACCGGGGAGCCATGGGCTTCCTGCTCATGTATGACATCGCCAATCA
GGAATCCTTTGCCGCTGTGCAGGACTGGGCCACGCAAATCAAGACCTACTCCTGGGACAACGCCCAGGTCATCCTGGTGG
GGAACAAGTGTGACCTGGAGGACGAACGTGTTGTGCCTGCTGAGGATGGCCGGAGGCTCGCCGACGACCTTGGTTTCGAG
TTCTTTGAAGCCAGTGCCAAGGAGAACATCAATGTGAAGCAGGTCTTCGAGCGCCTGGTGGATGTCATCTGCGAGAAGAT
GAACGAGTCCCTGGAACCCAGCTCCAGCTCAGGCAGCAACGGGAAAGGCCCGGCCGTGGGGGATGCTCCAGCCCCCCAGC
CCAGCAGCTGCAGCTGCTAG

Protein (219aa)

>JHU00258
MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAG
QERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFE
FFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC