Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00257 RAB3B Homo sapiens Yes Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
11 1 9 JHU00257
11 1 10 JHU00257
HuProt v3.0
Block Row Column Clone
2 1 16 JHU00257
2 2 16 JHU00257
HuProt v3.1
Block Row Column Clone
2 1 16 JHU00257
2 2 16 JHU00257

External Database ID

Nucleotide (660bp)

>JHU00257
ATGGCTTCAGTGACAGATGGTAAAACTGGAGTCAAAGATGCCTCTGACCAGAATTTTGACTACATGTTTAAACTGCTTAT
CATTGGCAACAGCAGTGTTGGCAAGACCTCCTTCCTCTTCCGCTATGCTGATGACACGTTCACCCCAGCCTTCGTTAGCA
CCGTGGGCATCGACTTCAAGGTGAAGACAGTCTACCGTCACGAGAAGCGGGTGAAACTGCAGATCTGGGACACAGCTGGG
CAGGAGCGGTACCGGACCATCACAACAGCCTATTACCGTGGGGCCATGGGCTTCATTCTGATGTATGACATCACCAATGA
AGAGTCCTTCAATGCTGTCCAAGACTGGGCTACTCAGATCAAGACCTACTCCTGGGACAATGCACAAGTTATTCTGGTGG
GGAACAAGTGTGACATGGAGGAAGAGAGGGTTGTTCCCACTGAGAAGGGCCAGCTCCTTGCAGAGCAGCTTGGGTTTGAT
TTCTTTGAAGCCAGTGCAAAGGAGAACATCAGTGTAAGGCAGGCCTTTGAGCGCCTGGTGGATGCCATTTGTGACAAGAT
GTCTGATTCGCTGGACACAGACCCGTCGATGCTGGGCTCCTCCAAGAACACGCGTCTCTCGGACACCCCACCGCTGCTGC
AGCAGAACTGCTCATGCTAG

Protein (219aa)

>JHU00257
MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAG
QERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFD
FFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC