Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU02564 RNF24 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
10 1 5 JHU02564
10 1 6 JHU02564
33 4 11 JHU02564
33 4 12 JHU02564
39 24 27 JHU02564
39 24 28 JHU02564
HuProt v3.0
Block Row Column Clone
3 1 15 JHU02564
3 2 15 JHU02564
2 41 19 JHU02564
2 42 19 JHU02564
18 47 18 JHU02564
18 48 18 JHU02564
HuProt v3.1
Block Row Column Clone
3 1 15 JHU02564
3 2 15 JHU02564
2 41 19 JHU02564
2 42 19 JHU02564
18 47 18 JHU02564
18 48 18 JHU02564

External Database ID

Nucleotide (447bp)

>JHU02564
ATGAGCTCGGATTTCCCACATTACAACTTCAGGATGCCTAATATTGGATTCCAGAATCTGCCTCTCAACATATATATTGT
GGTTTTTGGTACTGCTATATTTGTCTTCATCCTTAGTTTACTCTTCTGTTGCTACTTGATTAGGCTAAGACATCAAGCAC
ACAAAGAATTTTATGCCTACAAACAGGTTATATTAAAAGAGAAAGTAAAAGAATTGAATTTACATGAGCTCTGTGCAGTG
TGCCTAGAAGACTTCAAGCCTCGAGATGAGTTGGGGATTTGCCCATGTAAGCACGCCTTCCACAGAAAGTGCCTTATTAA
GTGGCTGGAGGTTCGTAAAGTGTGTCCCCTGTGCAACATGCCAGTTCTACAGCTGGCCCAGTTGCACAGTAAGCAGGACC
GTGGACCCCCTCAGGGGCCCCTTCCTGGGGCAGAGAACATTGTATAG

Protein (148aa)

>JHU02564
MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAYKQVILKEKVKELNLHELCAV
CLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGPLPGAENIV