Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00255 RAB35 RAB1C;RAY Homo sapiens Yes Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
17 1 5 JHU00255
17 1 6 JHU00255
HuProt v3.0
Block Row Column Clone
3 1 19 JHU00255
3 2 19 JHU00255
HuProt v3.1
Block Row Column Clone
3 1 19 JHU00255
3 2 19 JHU00255

External Database ID

Nucleotide (606bp)

>JHU00255
ATGGCCCGGGACTACGACCACCTCTTCAAGCTGCTCATCATCGGCGACAGCGGTGTGGGCAAGAGCAGTTTACTGTTGCG
TTTTGCAGACAACACTTTCTCAGGCAGCTACATCACCACGATCGGAGTGGATTTCAAGATCCGGACCGTGGAGATCAACG
GGGAGAAGGTGAAGCTGCAGATCTGGGACACAGCGGGGCAGGAGCGCTTCCGCACCATCACCTCCACGTATTATCGGGGG
ACCCACGGGGTCATTGTGGTTTACGACGTCACCAGTGCCGAGTCCTTTGTCAACGTCAAGCGGTGGCTTCACGAAATCAA
CCAGAACTGTGATGATGTGTGCCGAATATTAGTGGGTAATAAGAATGACGACCCTGAGCGGAAGGTGGTGGAGACGGAAG
ATGCCTACAAATTCGCCGGGCAGATGGGCATCCAGTTGTTCGAGACCAGCGCCAAGGAGAATGTCAACGTGGAAGAGATG
TTCAACTGCATCACGGAGCTGGTCCTCCGAGCAAAGAAAGACAACCTGGCAAAACAGCAGCAGCAACAACAGAACGATGT
GGTGAAGCTCACGAAGAACAGTAAACGAAAGAAACGCTGCTGCTAG

Protein (201aa)

>JHU00255
MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRG
THGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEM
FNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC