Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00254 RAB34 RAB39;RAH Homo sapiens Yes Signal Transduction

HuProt v2.0
Block Row Column Clone
27 1 5 JHU00254
27 1 6 JHU00254
34 1 25 JHU00254
34 1 26 JHU00254
HuProt v3.0
Block Row Column Clone
3 1 24 JHU00254
3 2 24 JHU00254
2 9 5 JHU00254
2 10 5 JHU00254
HuProt v3.1
Block Row Column Clone
3 1 24 JHU00254
3 2 24 JHU00254
2 9 5 JHU00254
2 10 5 JHU00254

External Database ID

Nucleotide (756bp)

>JHU00254
ATGAACATTCTGGCACCCGTGCGGAGGGATCGCGTCCTGGCGGAGCTGCCCCAGTGCCTGAGGAAGGAGGCCGCTTTGCA
CGGGCACAAAGACTTCCACCCCCGCGTCACCTGCGCCTGCCAGGAGCACCGGACAGGCACCGTGGGATTTAAGATCTCCA
AGGTCATTGTGGTGGGGGACCTGTCGGTGGGGAAGACTTGCCTCATTAATAGGTTCTGCAAAGACACCTTTGATAAGAAT
TACAAGGCCACCATTGGAGTGGACTTCGAGATGGAACGATTTGAGGTGCTGGGCATTCCCTTCAGTTTGCAGCTTTGGGA
TACCGCTGGGCAGGAGAGGTTCAAATGCATTGCATCAACCTACTATAGAGGAGCTCAAGCCATCATCATTGTCTTCAACC
TGAATGATGTGGCATCTCTGGAACATACCAAGCAGTGGCTGGCCGATGCCCTGAAGGAGAATGACCCTTCCAGTGTGCTT
CTCTTCCTTACCCCTGCTCAGTATGCGCTGATGGAGAAAGACGCCCTCCAGGTGGCCCAGGAGATGAAGGCTGAGTACTG
GGCAGTCTCATCTCTCACTGGTGAGAATGTCCGAGAATTCTTCTTCCGTGTGGCAGCACTGACCTTTGAGGCCAATGTGC
TGGCTGAGCTGGAGAAATCGGGGGCTCGACGCATTGGGGATGTTGTCCGCATCAACAGTGATGACAGCAACCTCTACCTA
ACTGCCAGCAAGAAGAAGCCCACATGTTGCCCATAG

Protein (251aa)

>JHU00254
MNILAPVRRDRVLAELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKN
YKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKENDPSSVL
LFLTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYL
TASKKKPTCCP