Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00253 RAB33A RABS10 Homo sapiens Yes Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
3 1 9 JHU00253
3 1 10 JHU00253
HuProt v3.0
Block Row Column Clone
2 1 6 JHU00253
2 2 6 JHU00253
HuProt v3.1
Block Row Column Clone
2 1 6 JHU00253
2 2 6 JHU00253

External Database ID

Nucleotide (714bp)

>JHU00253
ATGGCGCAGCCCATCCTGGGCCATGGGAGCCTGCAGCCCGCCTCGGCCGCTGGCCTGGCGTCCCTGGAGCTCGACTCGTC
GCTGGACCAGTACGTGCAGATTCGCATCTTCAAAATAATCGTGATTGGGGACTCCAACGTGGGCAAGACCTGCCTGACCT
TCCGCTTCTGCGGGGGTACCTTCCCAGACAAGACTGAAGCCACCATCGGCGTGGACTTCAGGGAGAAGACCGTGGAAATC
GAGGGCGAGAAGATCAAGGTTCAGGTGTGGGACACAGCAGGTCAGGAACGTTTCCGCAAAAGCATGGTCGAGCATTACTA
CCGCAACGTACATGCCGTGGTCTTCGTCTATGACGTCACCAAGATGACATCTTTCACCAACCTCAAAATGTGGATCCAAG
AATGCAATGGGCATGCTGTGCCCCCACTAGTCCCCAAAGTGCTTGTGGGCAACAAGTGTGACTTGAGGGAACAGATCCAG
GTGCCCTCCAACTTAGCCCTGAAATTTGCTGATGCCCACAACATGCTCTTGTTTGAGACATCGGCCAAGGACCCCAAAGA
GAGCCAGAACGTGGAGTCGATTTTCATGTGCTTGGCTTGCCGATTGAAGGCCCAGAAATCCCTGCTGTATCGTGATGCTG
AGAGGCAGCAGGGGAAGGTGCAGAAACTGGAGTTCCCACAGGAAGCTAACAGTAAAACTTCCTGTCCTTGTTAG

Protein (237aa)

>JHU00253
MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEI
EGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQ
VPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC