Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00252 RAB22A RAB22 Homo sapiens Yes Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
19 1 5 JHU00252
19 1 6 JHU00252
HuProt v3.0
Block Row Column Clone
3 1 4 JHU00252
3 2 4 JHU00252
HuProt v3.1
Block Row Column Clone
3 1 4 JHU00252
3 2 4 JHU00252

External Database ID

Nucleotide (585bp)

>JHU00252
ATGGCGCTGAGGGAGCTCAAAGTGTGTCTGCTCGGGGATACAGGTGTAGGTAAATCGAGTATTGTGTGGCGGTTTGTGGA
AGACAGTTTTGATCCAAACATCAACCCAACAATAGGGGCATCTTTTATGACCAAGACTGTCCAGTACCAAAATGAGCTAC
ATAAATTCCTAATCTGGGATACAGCTGGACAAGAACGATTTCGTGCCTTAGCACCAATGTACTATCGAGGGTCGGCTGCA
GCTATAATCGTTTATGATATCACAAAAGAAGAGACATTTTCAACATTAAAGAATTGGGTGAAAGAGCTTCGACAGCATGG
CCCACCTAATATTGTAGTTGCCATTGCAGGAAATAAATGTGATCTTATCGATGTAAGAGAAGTCATGGAGAGAGATGCAA
AGGACTACGCCGACTCTATTCATGCAATTTTTGTAGAGACCAGCGCAAAAAACGCGATAAACATAAATGAACTCTTTATA
GAAATTAGTCGAAGAATTCCATCCACTGACGCCAACCTGCCATCTGGCGGTAAGGGCTTCAAACTCCGAAGACAGCCTTC
AGAGCCAAAGCGGAGCTGCTGCTAG

Protein (194aa)

>JHU00252
MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAA
AIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFI
EISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC