Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00251 RAB18 Homo sapiens Yes Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
17 1 9 JHU00251
17 1 10 JHU00251
HuProt v3.0
Block Row Column Clone
2 1 19 JHU00251
2 2 19 JHU00251
HuProt v3.1
Block Row Column Clone
2 1 19 JHU00251
2 2 19 JHU00251

External Database ID

Nucleotide (621bp)

>JHU00251
ATGGACGAGGACGTGCTAACCACCCTGAAGATCCTCATCATCGGCGAGAGTGGGGTGGGCAAGTCCAGCCTGCTCTTGAG
GTTCACAGATGATACGTTTGATCCAGAACTTGCAGCAACAATAGGTGTTGACTTTAAGGTGAAAACAATTTCAGTGGATG
GAAATAAGGCTAAACTTGCAATATGGGATACTGCTGGTCAAGAGAGGTTTAGAACATTAACTCCCAGCTATTATAGAGGT
GCACAGGGTGTTATATTAGTTTATGATGTCACAAGAAGAGATACATTTGTTAAACTGGATAATTGGTTAAATGAATTGGA
AACATACTGTACAAGAAATGACATAGTAAACATGCTAGTTGGAAATAAAATCGATAAGGAAAATCGTGAAGTCGATAGAA
ATGAAGGCCTGAAATTTGCACGAAAGCATTCCATGTTATTTATAGAGGCAAGTGCAAAAACCTGTGATGGTGTACAATGT
GCCTTTGAAGAACTTGTTGAAAAGATCATTCAGACCCCTGGACTGTGGGAAAGTGAGAACCAGAATAAAGGAGTCAAACT
GTCACACAGGGAAGAAGGCCAAGGAGGAGGAGCCTGTGGTGGTTATTGCTCTGTGTTATAG

Protein (206aa)

>JHU00251
MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRG
AQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQC
AFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL