Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00250 RAB14 Homo sapiens Yes Signal Transduction

HuProt v2.0
Block Row Column Clone
9 1 13 JHU00250
9 1 14 JHU00250
HuProt v3.0
Block Row Column Clone
1 1 11 JHU00250
1 2 11 JHU00250
HuProt v3.1
Block Row Column Clone
1 1 11 JHU00250
1 2 11 JHU00250

External Database ID

Nucleotide (648bp)

>JHU00250
ATGGCAACTGCACCATACAACTACTCTTACATCTTTAAATATATTATTATTGGGGACATGGGAGTAGGAAAATCTTGCTT
GCTTCATCAATTTACAGAAAAAAAATTTATGGCTGATTGTCCTCACACAATTGGTGTTGAATTTGGTACAAGAATAATCG
AAGTTAGTGGCCAAAAAATAAAACTGCAGATTTGGGATACGGCAGGACAGGAGCGATTTAGGGCTGTTACACGGAGCTAC
TACAGAGGAGCTGCGGGAGCTCTTATGGTCTATGATATCACTAGAAGAAGTACATATAACCACTTAAGCAGCTGGTTGAC
AGATGCAAGGAATCTCACCAATCCAAATACTGTAATAATTCTCATAGGAAATAAAGCAGATTTGGAGGCACAGAGAGATG
TTACATATGAAGAAGCCAAACAGTTTGCTGAAGAAAATGGCTTATTGTTCCTCGAAGCGAGTGCAAAAACGGGAGAGAAT
GTAGAAGATGCCTTCCTTGAGGCTGCCAAGAAAATCTATCAGAACATTCAGGATGGAAGCTTGGATCTGAATGCTGCTGA
GTCTGGTGTACAACACAAACCTTCAGCCCCGCAGGGAGGCCGGCTAACCAGTGAACCCCAACCCCAGAGAGAAGGCTGTG
GCTGCTAG

Protein (215aa)

>JHU00250
MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSY
YRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGEN
VEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC