Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00025 DGKE DAGK5 Homo sapiens Yes Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
44 1 7 JHU00025
44 1 8 JHU00025
HuProt v3.0
Block Row Column Clone
3 5 26 JHU00025
3 6 26 JHU00025
HuProt v3.1
Block Row Column Clone
3 5 26 JHU00025
3 6 26 JHU00025

External Database ID

Nucleotide (534bp)

>JHU00025
ATGGAAGCGGAGAGGCGGCCGGCGCCGGGCTCGCCCTCCGAGGGCCTGTTTGCGGACGGGCACCTGATCTTGTGGACGCT
GTGCTCGGTTCTGCTGCCGGTGTTCATCACCTTCTGGTGTAGCCTCCAGCGGTCGCGCCGGCAGCTGCACCGCAGGGACA
TCTTCCGCAAGAGCAAGCACGGGTGGCGCGACACGGACCTGTTCAGCCAGCCCACCTACTGCTGCGTGTGCGCGCAGCAC
ATTCTGCAGGGCGCCTTCTGCGACTGCTGCGGGCTCCGCGTGGACGAGGGCTGCCTCAGGAAGGCCGACAAGCGCTTCCA
GTGCAAGGAGATTATGCTCAAGAATGACACCAAGGTCCTGGACGCCATGCCCCACCACTGGATCCGGGGCAACGTGCCCC
TGTGCAGTTACTGTATGGTTTGCAAGCAGCAGTGTGGCTGTCAACCCAAGCTTTGCGATTACAGGTATGGTCTTCGTGGA
CACTCACTGTCCCAGAATGCGCCGTGGGAATCAGGATTTCATAGAGTGGTGTAG

Protein (177aa)

>JHU00025
MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQH
ILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRYGLRG
HSLSQNAPWESGFHRVV