Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00244 NKIRAS2 KBRAS2 Homo sapiens Yes Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
11 1 5 JHU00244
11 1 6 JHU00244
HuProt v3.0
Block Row Column Clone
3 1 16 JHU00244
3 2 16 JHU00244
HuProt v3.1
Block Row Column Clone
3 1 16 JHU00244
3 2 16 JHU00244

External Database ID

Nucleotide (576bp)

>JHU00244
ATGGGGAAGAGCTGCAAGGTGGTCGTGTGTGGCCAGGCGTCTGTGGGCAAAACTTCAATCCTGGAGCAGCTTCTGTATGG
GAACCATGTAGTGGGTTCGGAGATGATCGAGACGCAGGAGGACATCTACGTGGGCTCCATTGAGACAGACCGGGGGGTGC
GAGAGCAGGTGCGTTTCTATGACACCCGGGGGCTCCGAGATGGGGCCGAACTGCCCCGACACTGCTTCTCTTGCACTGAT
GGCTACGTCCTGGTCTATAGCACAGATAGCAGAGAGTCTTTTCAGCGTGTGGAGCTGCTCAAGAAGGAGATTGACAAATC
CAAGGACAAGAAGGAGGTCACCATCGTGGTCCTTGGCAACAAGTGTGACTTACAGGAGCAGCGGCGTGTAGACCCAGATG
TGGCTCAGCACTGGGCCAAGTCAGAGAAGGTGAAGCTGTGGGAGGTGTCAGTGGCGGACCGGCGCTCCCTCCTGGAGCCC
TTTGTCTACTTGGCCAGCAAGATGACGCAACCCCAGAGCAAGTCTGCCTTCCCCCTCAGCCGGAAGAACAAGGGCAGCGG
CTCCTTGGATGGCTAG

Protein (191aa)

>JHU00244
MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTD
GYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEP
FVYLASKMTQPQSKSAFPLSRKNKGSGSLDG