Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00024 CSNK1G2 CK1G2 Homo sapiens Yes Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
26 1 3 JHU00024
26 1 4 JHU00024
23 24 25 JHU00024
23 24 26 JHU00024
HuProt v3.0
Block Row Column Clone
4 5 15 JHU00024
4 6 15 JHU00024
18 43 18 JHU00024
18 44 18 JHU00024
HuProt v3.1
Block Row Column Clone
4 5 15 JHU00024
4 6 15 JHU00024
18 43 18 JHU00024
18 44 18 JHU00024

External Database ID

Nucleotide (1248bp)

>JHU00024
ATGGATTTTGACAAGAAAGGAGGGAAAGGGGAGACGGAGGAGGGCCGGAGAATGTCCAAGGCCGGCGGGGGCCGGAGCAG
CCACGGCATCCGGAGCTCGGGGACCAGCTCGGGGGTCCTGATGGTGGGCCCCAACTTCCGCGTCGGCAAGAAGATCGGCT
GCGGCAACTTCGGGGAGCTCCGCCTAGGAAAGAATCTCTATACAAATGAATACGTGGCTATCAAATTGGAGCCGATCAAG
TCCCGGGCCCCGCAGCTGCACCTGGAGTACCGGTTCTACAAGCAGCTCAGCGCCACAGAGGGCGTCCCTCAGGTCTACTA
CTTCGGTCCGTGCGGGAATTACAACGCCATGGTGCTGGAGCTGCTGGGGCCCAGCCTGGAGGACCTGTTCGACCTGTGCG
ACCGGACCTTCACGCTCAAGACGGTGCTGATGATCGCCATCCAGCTGATCACGCGCATGGAGTATGTGCACACCAAGAGC
CTAATCTACCGGGACGTGAAGCCCGAGAACTTCCTGGTGGGCCGCCCGGGGACCAAGCGGCAGCATGCCATCCACATCAT
CGACTTCGGGCTGGCCAAGGAGTACATCGACCCCGAGACCAAGAAGCACATCCCGTACCGCGAGCACAAGAGCCTGACGG
GCACGGCGCGCTACATGAGCATCAACACGCACCTGGGCAAGGAGCAGAGCCGCCGCGACGACCTGGAGGCGCTGGGCCAC
ATGTTCATGTACTTCCTGCGCGGCAGCCTCCCCTGGCAGGGGCTCAAGGCCGACACGCTCAAGGAGCGGTACCAGAAGAT
CGGGGACACCAAACGCGCCACGCCCATCGAGGTGCTCTGCGAGAACTTCCCAGAGGAGATGGCCACGTACCTGCGCTATG
TGCGGCGCCTGGACTTCTTCGAGAAGCCCGACTATGACTACCTGCGGAAGCTCTTCACCGACCTCTTCGACCGCAGTGGC
TTCGTGTTCGACTATGAGTACGACTGGGCCGGGAAGCCCCTGCCGACCCCCATCGGCACCGTCCACACCGACCTGCCCTC
CCAGCCTCAGCTCCGGGACAAAACCCAGCCGCACAGCAAAAACCAGGCGTTGAACTCCACCAACGGGGAGCTGAATGCGG
ACGACCCCACGGCCGGCCACTCCAACGCCCCGATCACAGCGCCTGCAGAGGTGGAGGTGGCCGATGAAACCAAATGCTGC
TGTTTCTTCAAGAGGAGAAAGAGAAAATCGCTGCAGCGACACAAGTAG

Protein (415aa)

>JHU00024
MDFDKKGGKGETEEGRRMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIK
SRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGNYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKS
LIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSG
FVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCC
CFFKRRKRKSLQRHK