Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00232 KCNMB2 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
33 1 7 JHU00232
33 1 8 JHU00232
HuProt v3.0
Block Row Column Clone
3 5 19 JHU00232
3 6 19 JHU00232
HuProt v3.1
Block Row Column Clone
3 5 19 JHU00232
3 6 19 JHU00232
24 51 1 JHU00232
24 52 1 JHU00232

External Database ID

Nucleotide (708bp)

>JHU00232
ATGTTTATATGGACCAGTGGCCGGACCTCTTCATCTTATAGACATGATGAAAAAAGAAATATTTACCAGAAAATCAGGGA
CCATGACCTCCTGGACAAAAGGAAAACAGTCACAGCACTGAAGGCAGGAGAGGACCGAGCTATTCTCCTGGGACTGGCTA
TGATGGTGTGCTCCATCATGATGTATTTTCTGCTGGGAATCACACTCCTGCGCTCATACATGCAGAGCGTGTGGACCGAA
GAGTCTCAATGCACCTTGCTGAATGCGTCCATCACGGAAACATTTAACTGCTCCTTCAGCTGTGGTCCAGACTGCTGGAA
ACTTTCTCAGTACCCCTGCCTCCAGGTGTACGTTAACCTGACTTCTTCCGGGGAAAAGCTCCTCCTCTACCACACAGAAG
AGACAATAAAAATCAATCAGAAGTGCTCCTATATACCTAAATGTGGAAAAAATTTTGAAGAATCCATGTCCCTGGTGAAT
GTTGTCATGGAAAACTTCAGGAAGTATCAACACTTCTCCTGCTATTCTGACCCAGAAGGAAACCAGAAGAGTGTTATCCT
AACCAAACTCTACAGTTCCAACGTGCTGTTCCATTCACTCTTCTGGCCAACCTGTATGATGGCTGGGGGTGTGGCAATTG
TTGCCATGGTGAAACTTACACAGTACCTCTCCCTACTATGTGAGAGGATCCAACGGATCAATAGATAG

Protein (235aa)

>JHU00232
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLLRSYMQSVWTE
ESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVN
VVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR