Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00023 CRK Homo sapiens Yes Kinases; Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
44 1 15 JHU00023
44 1 16 JHU00023
HuProt v3.0
Block Row Column Clone
1 5 26 JHU00023
1 6 26 JHU00023
HuProt v3.1
Block Row Column Clone
1 5 26 JHU00023
1 6 26 JHU00023

External Database ID

Nucleotide (615bp)

>JHU00023
ATGGCGGGCAACTTCGACTCGGAGGAGCGGAGTAGCTGGTACTGGGGGAGGTTGAGTCGGCAGGAGGCGGTGGCGCTGCT
GCAGGGCCAGCGGCACGGGGTGTTCCTGGTGCGGGACTCGAGCACCAGCCCCGGGGACTATGTGCTCAGCGTCTCAGAGA
ACTCGCGCGTCTCCCACTACATCATCAACAGCAGCGGCCCGCGCCCGCCGGTGCCACCGTCGCCCGCCCAGCCTCCGCCC
GGGGTGAGCCCCTCCAGACTCCGAATAGGAGATCAAGAGTTTGATTCATTGCCTGCTTTACTGGAATTCTACAAAATACA
CTATTTGGACACTACAACGTTGATAGAACCAGTTTCCAGATCCAGGCAGGGTAGTGGAGTGATTCTCAGGCAGGAGGAGG
CGGAGTATGTGCGAGCCCTCTTTGACTTTAATGGGAATGATGAGGAAGATCTTCCCTTTAAGAAAGGAGACATCTTGAGA
ATCCGGGACAAGCCTGAAGAGCAGTGGTGGAATGCGGAGGACAGCGAAGGCAAGAGAGGGATGATTCCAGTCCCTTACGT
CGAGAAGTATAGACCTGCCTCCGCCTCAGTATCGGCTCTGATTGGAGGTCGGTAG

Protein (204aa)

>JHU00023
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP
GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR
IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGR