Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19892 ZNF521 EHZF;LIP3 Homo sapiens No Nuclear Proteins; Signal Transduction; Transcription Factors

HuProt v2.0
Block Row Column Clone
29 23 29 JHU19892
29 23 30 JHU19892
45 23 29 JHU19892
45 23 30 JHU19892
19 26 29 JHU19892
19 26 30 JHU19892
HuProt v3.0
Block Row Column Clone
17 31 31 JHU19892
17 32 31 JHU19892
17 33 13 JHU19892
17 34 13 JHU19892
21 7 4 JHU19892
21 8 4 JHU19892
HuProt v3.1
Block Row Column Clone
17 31 31 JHU19892
17 32 31 JHU19892
17 33 13 JHU19892
17 34 13 JHU19892
21 7 4 JHU19892
21 8 4 JHU19892

External Database ID

Nucleotide (3933bp)

>JHU19892
ATGTCTCGCCGCAAGCAAGCGAAACCGAGATCCCTCAAAGACCCCAACTGTAAACTTGAAGACAAGACTGAAGATGGAGA
GGCACTAGATTGTAAGAAGAGGCCGGAAGACGGGGAGGAGTTGGAAGACGAAGCTGTGCACAGCTGTGACAGCTGCCTCC
AGGTGTTTGAATCGCTGAGCGATATCACAGAACACAAGATTAATCAATGTCAACTGACAGATGGAGTGGATGTTGAAGAT
GATCCGACTTGCTCTTGGCCAGCTTCCTCACCTTCTAGCAAGGATCAGACTTCCCCTAGCCATGGAGAAGGTTGCGATTT
TGGAGAGGAAGAAGGTGGCCCTGGGCTTCCATACCCGTGTCAATTCTGTGACAAGTCGTTTAGCCGCCTCAGCTACCTAA
AGCACCATGAGCAGAGTCACAGTGACAAACTGCCTTTCAAATGCACCTACTGCAGTAGGCTGTTCAAACACAAGCGCAGC
CGAGATCGCCACATAAAACTCCACACCGGGGACAAGAAGTACCACTGCAGTGAATGTGATGCTGCGTTTTCCAGAAGTGA
TCACTTGAAGATCCACTTAAAGACTCACACGTCCAACAAGCCATATAAATGTGCCATTTGTCGCCGTGGGTTTCTGTCCT
CTAGTTCCTTACACGGACACATGCAGGTTCATGAGAGGAACAAGGACGGCTCTCAGTCCGGTTCCAGGATGGAGGACTGG
AAGATGAAGGACACTCAGAAGTGCAGTCAGTGTGAGGAAGGCTTTGACTTCCCGGAAGACCTCCAAAAACACATTGCAGA
GTGCCACCCCGAATGCTCCCCAAATGAGGACCGAGCGGCCCTCCAGTGTGTCTACTGCCACGAGCTCTTCGTAGAGGAGA
CCTCCCTCATGAACCACATGGAGCAGGTGCATAGCGGGGAGAAGAAGAACTCATGCAGCATTTGTTCTGAGAGTTTCCAC
ACAGTTGAGGAACTGTACAGCCACATGGACAGTCACCAGCAACCGGAGTCATGCAATCACAGCAACAGCCCTTCCCTGGT
CACGGTGGGCTATACCTCCGTGTCCAGTACGACTCCAGATTCCAACCTCTCAGTGGACAGCTCAACCATGGTGGAAGCTG
CCCCGCCAATCCCAAAGAGTCGAGGGAGGAAGAGGGCCGCTCAACAAACCCCTGACATGACTGGTCCCTCGAGTAAACAA
GCAAAAGTTACCTACAGCTGTATTTACTGCAACAAACAATTATTTTCAAGTCTTGCAGTTCTGCAGATTCACCTGAAAAC
TATGCACTTAGATAAGCCAGAACAGGCCCATATTTGTCAGTATTGCTTGGAGGTCCTGCCCTCACTCTATAACCTAAATG
AACATCTTAAGCAAGTGCATGAAGCTCAGGACCCAGGTCTGATTGTTTCTGCCATGCCTGCCATTGTCTACCAGTGTAAC
TTCTGTTCCGAAGTTGTCAACGACCTCAACACTCTTCAGGAACACATCCGATGTTCTCATGGATTTGCAAACCCTGCAGC
TAAAGATAGTAATGCATTCTTTTGTCCCCATTGCTATATGGGGTTTCTCACTGACTCTTCCCTGGAAGAGCATATTAGAC
AGGTTCATTGTGACCTCAGTGGCTCCCGATTTGGGTCTCCAGTGCTTGGGACTCCCAAAGAACCAGTAGTAGAAGTCTAT
TCTTGTTCCTATTGTACAAATTCGCCAATATTCAACAGCGTTCTTAAACTGAACAAGCATATCAAAGAGAATCATAAAAA
CATTCCCTTGGCCCTGAATTATATCCACAATGGGAAGAAATCCAGGGCCTTAAGCCCCCTATCTCCTGTGGCCATAGAGC
AGACATCTCTTAAGATGATGCAGGCAGTAGGAGGTGCACCTGCACGTCCCACTGGAGAATATATCTGTAATCAATGTGGT
GCTAAGTACACATCCCTAGACAGCTTTCAGACTCACCTAAAAACTCATCTCGACACTGTGCTTCCAAAATTGACCTGTCC
TCAGTGCAACAAGGAATTCCCCAACCAAGAATCCTTGCTGAAGCATGTTACCATTCACTTTATGATCACTTCAACGTATT
ACATCTGTGAGAGTTGTGACAAGCAATTCACATCAGTGGATGACCTTCAGAAACACCTGCTGGACATGCACACCTTTGTC
TTCTTTCGCTGCACCCTCTGCCAGGAAGTTTTTGACTCAAAAGTCTCCATTCAGCTCCACTTGGCTGTGAAGCACAGTAA
CGAAAAGAAAGTCTATAGGTGCACATCTTGCAACTGGGACTTCCGCAACGAAACTGACTTGCAGCTCCATGTGAAACACA
ACCACCTGGAAAACCAAGGGAAAGTGCATAAGTGCATTTTCTGCGGTGAGTCCTTTGGCACCGAGGTGGAGCTGCAATGC
CACATCACCACTCACAGTAAGAAGTACAACTGCAAGTTCTGTAGCAAAGCCTTCCATGCGATCATTTTGTTAGAAAAACA
CTTGCGAGAAAAACACTGTGTATTCGAAACCAAGACACCCAACTGTGGAACAAATGGAGCTTCCGAGCAAGTGCAGAAAG
AGGAAGTGGAGCTGCAGACTTTGCTGACCAACAGCCAGGAGTCCCACAACAGTCACGATGGGAGCGAAGAAGACGTTGAC
ACCTCTGAGCCTATGTACGGCTGCGACATTTGTGGGGCAGCCTACACTATGGAAACTTTGCTGCAGAATCACCAGCTCCG
AGACCACAACATCAGACCTGGAGAAAGTGCCATCGTGAAAAAGAAAGCTGAGCTCATTAAAGGGAATTACAAGTGCAACG
TGTGCTCTCGAACCTTCTTCTCCGAAAATGGCCTCCGGGAACATATGCAGACCCACCTAGGCCCTGTCAAACACTACATG
TGCCCTATTTGCGGAGAGCGGTTTCCCTCCCTTTTAACTCTTACTGAACACAAAGTCACGCATAGTAAGAGTCTTGATAC
TGGAAACTGCCGGATTTGCAAGATGCCTCTCCAGAGTGAAGAGGAGTTTTTAGAGCATTGCCAAATGCACCCTGACTTGA
GGAATTCCCTGACAGGCTTTCGCTGCGTGGTGTGCATGCAGACAGTGACCTCCACCTTGGAACTCAAAATCCATGGGACG
TTCCACATGCAAAAGACAGGGAATGGGTCTGCAGTTCAGACCACAGGGCGGGGCCAGCACGTCCAAAAACTGTATAAGTG
CGCATCTTGCCTCAAAGAATTCCGTTCCAAGCAAGATCTGGTGAAACTTGATATCAATGGCCTGCCATATGGTCTGTGTG
CCGGCTGCGTGAATCTCAGTAAGAGCGCCAGCCCAGGCATTAACGTCCCTCCCGGCACGAATAGACCAGGCTTGGGCCAG
AATGAGAATCTGAGTGCCATTGAGGGGAAAGGCAAGGTGGGGGGACTGAAGACACGCTGCTCTAGCTGCAACGTTAAGTT
TGAGTCTGAAAGTGAACTCCAGAACCACATCCAAACCATCCACCGAGAGCTCGTGCCAGACAGCAACAGCACACAGTTGA
AAACGCCCCAAGTATCACCAATGCCCAGAATCAGTCCCTCCCAGTCGGATGAGAAGAAGACCTATCAATGCATCAAATGT
CAGATGGTTTTCTACAATGAATGGGATATTCAGGTTCATGTTGCAAATCACATGATTGATGAAGGACTGAACCATGAATG
CAAACTCTGCAGCCAGACCTTTGACTCTCCTGCCAAACTCCAGTGCCACCTGATAGAGCACAGCTTCGAAGGGATGGGAG
GCACCTTCAAGTGTCCAGTCTGCTTTACAGTATTTGTTCAAGCAAACAAGTTGCAGCAGCATATTTTCTCTGCCCATGGA
CAAGAAGACAAGATCTATGACTGTACACAATGTCCACAGAAGTTTTTCTTCCAAACAGAGCTGCAGAATCATACAATGAC
CCAACACAGCAGT

Protein (1311aa)

>JHU19892
MSRRKQAKPRSLKDPNCKLEDKTEDGEALDCKKRPEDGEELEDEAVHSCDSCLQVFESLSDITEHKINQCQLTDGVDVED
DPTCSWPASSPSSKDQTSPSHGEGCDFGEEEGGPGLPYPCQFCDKSFSRLSYLKHHEQSHSDKLPFKCTYCSRLFKHKRS
RDRHIKLHTGDKKYHCSECDAAFSRSDHLKIHLKTHTSNKPYKCAICRRGFLSSSSLHGHMQVHERNKDGSQSGSRMEDW
KMKDTQKCSQCEEGFDFPEDLQKHIAECHPECSPNEDRAALQCVYCHELFVEETSLMNHMEQVHSGEKKNSCSICSESFH
TVEELYSHMDSHQQPESCNHSNSPSLVTVGYTSVSSTTPDSNLSVDSSTMVEAAPPIPKSRGRKRAAQQTPDMTGPSSKQ
AKVTYSCIYCNKQLFSSLAVLQIHLKTMHLDKPEQAHICQYCLEVLPSLYNLNEHLKQVHEAQDPGLIVSAMPAIVYQCN
FCSEVVNDLNTLQEHIRCSHGFANPAAKDSNAFFCPHCYMGFLTDSSLEEHIRQVHCDLSGSRFGSPVLGTPKEPVVEVY
SCSYCTNSPIFNSVLKLNKHIKENHKNIPLALNYIHNGKKSRALSPLSPVAIEQTSLKMMQAVGGAPARPTGEYICNQCG
AKYTSLDSFQTHLKTHLDTVLPKLTCPQCNKEFPNQESLLKHVTIHFMITSTYYICESCDKQFTSVDDLQKHLLDMHTFV
FFRCTLCQEVFDSKVSIQLHLAVKHSNEKKVYRCTSCNWDFRNETDLQLHVKHNHLENQGKVHKCIFCGESFGTEVELQC
HITTHSKKYNCKFCSKAFHAIILLEKHLREKHCVFETKTPNCGTNGASEQVQKEEVELQTLLTNSQESHNSHDGSEEDVD
TSEPMYGCDICGAAYTMETLLQNHQLRDHNIRPGESAIVKKKAELIKGNYKCNVCSRTFFSENGLREHMQTHLGPVKHYM
CPICGERFPSLLTLTEHKVTHSKSLDTGNCRICKMPLQSEEEFLEHCQMHPDLRNSLTGFRCVVCMQTVTSTLELKIHGT
FHMQKTGNGSAVQTTGRGQHVQKLYKCASCLKEFRSKQDLVKLDINGLPYGLCAGCVNLSKSASPGINVPPGTNRPGLGQ
NENLSAIEGKGKVGGLKTRCSSCNVKFESESELQNHIQTIHRELVPDSNSTQLKTPQVSPMPRISPSQSDEKKTYQCIKC
QMVFYNEWDIQVHVANHMIDEGLNHECKLCSQTFDSPAKLQCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFSAHG
QEDKIYDCTQCPQKFFFQTELQNHTMTQHSS