Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19874 ZNF225 Homo sapiens No Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
29 23 17 JHU19874
29 23 18 JHU19874
HuProt v3.0
Block Row Column Clone
20 31 31 JHU19874
20 32 31 JHU19874
HuProt v3.1
Block Row Column Clone
20 31 31 JHU19874
20 32 31 JHU19874

External Database ID

Nucleotide (2118bp)

>JHU19874
ATGACCACGTTGAAGGAGGCAGTGACCTTCAAGGACGTGGCTGTGGTCTTCACTGAGGAAGAGCTGAGGCTGCTGGACCT
TGCCCAGAGGAAACTGTACCGAGAAGTGATGCTGGAGAACTTCAGGAACCTGCTCTCAGTGGGGCATCAATCACTCCACA
GAGATACTTTCCACTTCCTAAAGGAAGAAAAGTTTTGGATGATGGAGACAGCAACCCAAAGAGAAGGGAATTTAGGAGGC
AAGATCCAAATGGAGATGGAGACTGTTTCAGAATCAGGAACACATGAAGGCTTGTTCAGTCATCAAACCTGGGAACAAAT
TTCAAGTGACTTAACCAGGTTTCAAGACTCCATGGTAAACAGCTTTCAGTTCTCCAAACAAGATGATATGCCCTGCCAGG
TTGATGCAGGACTATCTATAATTCACGTAAGACAGAAACCTTCTGAGGGTAGGACGTGTAAAAAGTCCTTTAGTGATGTC
TCCGTCCTTGATCTTCATCAACAACTACAGTCAAGAGAGAAGTCTCATACATGTGATGAATGTGGAAAGAGTTTCTGTTA
TAGCTCAGCTCTTCGTATTCATCAGAGAGTTCACATGGGGGAGAAACTCTATAATTGTGATGTGTGTGGTAAGGAATTCA
ATCAGAGCTCACATCTGCAAATTCATCAGAGAATCCACACTGGAGAGAAACCATTCAAATGTGAGCAGTGTGGGAAAGGC
TTTAGTCGTAGATCAGGACTTTATGTTCATCGTAAATTACACACAGGAGTGAAACCTCATATTTGTGAGAAATGTGGGAA
GGCCTTCATTCATGATTCCCAGCTTCAGGAACATCAAAGAATCCATACTGGGGAGAAGCCATTCAAATGTGATATATGTT
GTAAGAGCTTCCGTAGTAGAGCAAATCTTAATAGGCATTCCATGGTTCACATGCGAGAGAAACCATTCAGATGTGATACA
TGTGGTAAGAGCTTTGGTCTGAAATCAGCACTTAATAGTCATCGCATGGTCCACACAGGAGAGAAACGGTACAAATGTGA
GGAATGTGGAAAACGCTTCATTTATAGGCAAGATCTTTATAAGCATCAGATAGACCACACAGGGGAGAAGCCATATAATT
GTAAAGAATGTGGAAAGAGCTTCAGATGGGCCTCAGGTCTTTCAAGACATGTGCGAGTCCACAGTGGAGAGACAACATTC
AAATGTGAAGAATGTGGGAAGGGATTTTATACAAATTCACAACGTTATTCTCACCAGAGAGCGCACAGTGGAGAAAAGCC
ATATAGATGTGAGGAGTGTGGGAAGGGCTACAAAAGGAGGTTGGATCTTGACTTTCATCAGAGGGTCCACAGAGGAGAGA
AACCCTATAATTGTAAGGAATGTGGGAAGAGCTTTGGCTGGGCCTCGTGTCTTTTGAATCATCAGAGAATCCACAGTGGA
GAAAAACCATTTAAATGTGAAGAATGTGGGAAAAGATTTACTCAGAATTCACAACTTTATACCCATCGTAGAGTCCACAG
TGGAGAAAAACCATTCAAATGTGAAGAGTGTGGGAAAAGATTTACTCAGAATTCACAACTTTATTCTCATCGCAGAGTCC
ACACTGGAGTAAAGCCATACAAATGTGAAGAGTGTGGGAAGGGCTTCAACAGTAAGTTTAATCTTGACATGCACCAGAGG
GTCCACACCGGAGAGAGACCTTATAATTGTAAAGAATGTGGGAAGAGCTTTAGCCGGGCCTCAAGTATTTTGAATCATAA
GAGACTCCATGGTGATGAAAAGCCATTCAAATGTGAAGAGTGTGGGAAGAGATTTACTGAGAATTCACAGCTTCATTCCC
ATCAGAGGGTTCACACTGGGGAAAAGCCATACAAATGTGAGAAGTGTGGAAAGAGCTTCAGATGGGCCTCAACTCATCTA
ACCCATCAGAGACTCCACAGTAGAGAAAAACTACTTCAATGTGAGGACTGTGGGAAGAGCATTGTGCACAGTTCATGCCT
TAAAGACCAACAAAGAGACCAAAGTGGAGAGAAAACATCTAAATGTGAGGACTGTGGGAAGCGCTACAAGAGGCGCTTGA
ATCTTGATACGCTTTTGTCATTATTTTTAAATGACACA

Protein (706aa)

>JHU19874
MTTLKEAVTFKDVAVVFTEEELRLLDLAQRKLYREVMLENFRNLLSVGHQSLHRDTFHFLKEEKFWMMETATQREGNLGG
KIQMEMETVSESGTHEGLFSHQTWEQISSDLTRFQDSMVNSFQFSKQDDMPCQVDAGLSIIHVRQKPSEGRTCKKSFSDV
SVLDLHQQLQSREKSHTCDECGKSFCYSSALRIHQRVHMGEKLYNCDVCGKEFNQSSHLQIHQRIHTGEKPFKCEQCGKG
FSRRSGLYVHRKLHTGVKPHICEKCGKAFIHDSQLQEHQRIHTGEKPFKCDICCKSFRSRANLNRHSMVHMREKPFRCDT
CGKSFGLKSALNSHRMVHTGEKRYKCEECGKRFIYRQDLYKHQIDHTGEKPYNCKECGKSFRWASGLSRHVRVHSGETTF
KCEECGKGFYTNSQRYSHQRAHSGEKPYRCEECGKGYKRRLDLDFHQRVHRGEKPYNCKECGKSFGWASCLLNHQRIHSG
EKPFKCEECGKRFTQNSQLYTHRRVHSGEKPFKCEECGKRFTQNSQLYSHRRVHTGVKPYKCEECGKGFNSKFNLDMHQR
VHTGERPYNCKECGKSFSRASSILNHKRLHGDEKPFKCEECGKRFTENSQLHSHQRVHTGEKPYKCEKCGKSFRWASTHL
THQRLHSREKLLQCEDCGKSIVHSSCLKDQQRDQSGEKTSKCEDCGKRYKRRLNLDTLLSLFLNDT