Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19872 ZNF217 ZABC1 Homo sapiens No Cell Death; Nuclear Proteins; Signal Transduction; Transcription Factors

HuProt v2.0
Block Row Column Clone
21 23 25 JHU19872
21 23 26 JHU19872
HuProt v3.0
Block Row Column Clone
18 31 21 JHU19872
18 32 21 JHU19872
HuProt v3.1
Block Row Column Clone
18 31 21 JHU19872
18 32 21 JHU19872

External Database ID

Nucleotide (3144bp)

>JHU19872
ATGCAATCGAAAGTGACAGGAAACATGCCAACTCAATCCCTCTTAATGTACATGGATGGGCCAGAAGTGATTGGCAGCTC
TCTTGGCAGTCCGATGGAGATGGAGGATGCCTTGTCAATGAAAGGGACCGCTGTTGTTCCATTCCGAGCTACACAAGAAA
AAAATGTCATCCAAATCGAGGGGTATATGCCCTTGGATTGCATGTTCTGCAGCCAGACCTTCACACATTCAGAAGACCTT
AATAAACATGTCTTAATGCAACACCGGCCTACCCTCTGTGAACCAGCAGTTCTTCGGGTTGAAGCAGAGTATCTCAGTCC
GCTTGATAAAAGTCAAGTGCGAACAGAACCTCCCAAGGAAAAGAATTGCAAGGAAAATGAATTTAGCTGTGAGGTATGTG
GGCAGACATTTAGAGTCGCTTTTGATGTTGAGATCCACATGAGAACACACAAAGATTCTTTCACTTACGGGTGTAACATG
TGCGGAAGAAGATTCAAGGAGCCTTGGTTTCTTAAAAATCACATGCGGACACATAATGGCAAATCGGGGGCCAGAAGCAA
ACTGCAGCAAGGCTTGGAGAGTAGTCCAGCAACGATCAACGAGGTCGTCCAGGTGCACGCGGCCGAGAGCATCTCCTCTC
CTTACAAAATCTGCATGGTTTGTGGCTTCCTATTTCCAAATAAAGAAAGTCTAATTGAGCACCGCAAGGTGCACACCAAA
AAAACTGCTTTCGGTACCAGCAGCGCGCAGACAGACTCTCCACAAGGAGGAATGCCGTCCTCGAGGGAGGACTTCCTGCA
GTTGTTCAACTTGAGACCAAAATCTCACCCTGAAACGGGGAAGAAGCCTGTCAGATGCATCCCTCAGCTCGATCCGTTCA
CCACCTTCCAGGCTTGGCAGCTGGCTACCAAAGGAAAAGTTGCCATTTGCCAAGAAGTGAAGGAATCGGGGCAAGAAGGG
AGCACCGACAACGACGATTCGAGTTCCGAGAAGGAGCTTGGAGAAACAAATAAGGGCAGTTGTGCAGGCCTCTCGCAAGA
GAAAGAGAAGTGCAAACACTCCCACGGCGAAGCGCCCTCCGTGGACGCGGATCCCAAGTTACCCAGTAGCAAGGAGAAGC
CCACTCACTGCTCCGAGTGCGGCAAAGCTTTCAGAACCTACCACCAGCTGGTCTTGCACTCCAGGGTCCACAAGAAGGAC
CGGAGGGCCGGCGCGGAGTCGCCCACCATGTCTGTGGACGGGAGGCAGCCGGGGACGTGTTCTCCTGACCTCGCCGCCCC
TCTGGATGAAAATGGAGCCGTGGATCGAGGGGAAGGTGGTTCTGAAGACGGATCTGAGGATGGGCTTCCCGAAGGAATCC
ATCTGGATAAAAATGATGATGGAGGAAAAATAAAACATCTTACATCTTCAAGAGAGTGTAGTTATTGTGGAAAGTTTTTC
CGTTCAAATTATTACCTCAATATTCATCTCAGAACGCATACAGGTGAAAAACCATACAAATGTGAATTTTGTGAATATGC
TGCAGCCCAGAAGACATCTCTGAGGTATCACTTGGAGAGACATCACAAGGAAAAACAAACCGATGTTGCTGCTGAAGTCA
AGAACGATGGTAAAAATCAGGACACTGAAGATGCACTATTAACCGCTGACAGTGCGCAAACCAAAAATTTGAAAAGATTT
TTTGATGGTGCCAAAGATGTTACAGGCAGTCCACCTGCAAAGCAGCTTAAGGAGATGCCTTCTGTTTTTCAGAATGTTCT
GGGCAGCGCTGTCCTCTCACCAGCACACAAAGATACTCAGGATTTCCATAAAAATGCAGCTGATGACAGTGCTGATAAAG
TGAATAAAAACCCTACCCCTGCTTACCTGGACCTGTTAAAAAAGAGATCAGCAGTTGAAACTCAGGCAAATAACCTCATC
TGTAGAACCAAGGCGGATGTTACTCCTCCTCCGGATGGCAGTACCACCCATAACCTTGAAGTTAGCCCCAAAGAGAAGCA
AACGGAGACCGCAGCTGACTGCAGATACAGGCCAAGTGTGGATTGTCACGAAAAACCTTTAAATTTATCCGTGGGGGCTC
TTCACAATTGCCCGGCAATTTCTTTGAGTAAAAGTTTGATTCCAAGTATCACCTGTCCATTTTGTACCTTCAAGACATTT
TATCCAGAAGTTTTAATGATGCACCAGAGACTGGAGCATAAATACAATCCTGACGTTCATAAAAACTGTCGAAACAAGTC
CTTGCTTAGAAGTCGACGTACCGGATGCCCGCCAGCGTTGCTGGGAAAAGATGTGCCTCCCCTCTCTAGTTTCTGTAAAC
CCAAGCCCAAGTCTGCTTTCCCGGCGCAGTCCAAATCCCTGCCATCTGCGAAGGGGAAGCAGAGCCCTCCTGGGCCAGGC
AAGGCCCCTCTGACTTCAGGGATAGACTCTAGCACTTTAGCCCCAAGTAACCTGAAGTCCCACAGACCACAGCAGAATGT
GGGGGTCCAAGGGGCCGCCACCAGGCAACAGCAATCTGAGATGTTTCCTAAAACCAGTGTTTCCCCTGCACCGGATAAGA
CAAAAAGACCCGAGACAAAATTGAAACCTCTTCCAGTAGCTCCTTCTCAGCCCACCCTCGGCAGCAGTAACATCAATGGT
TCCATCGACTACCCCGCCAAGAACGACAGCCCGTGGGCACCTCCGGGAAGAGACTATTTCTGTAATCGGAGTGCCAGCAA
TACTGCAGCAGAATTTGGTGAGCCCCTTCCAAAAAGACTGAAGTCCAGCGTGGTTGCCCTTGACGTTGACCAGCCCGGGG
CCAATTACAGAAGAGGCTATGACCTTCCCAAGTACCATATGGTCAGAGGCATCACATCACTGTTACCGCAGGACTGTGTG
TATCCGTCGCAGGCGCTGCCTCCCAAACCAAGGTTCCTGAGCTCCAGCGAGGTCGATTCTCCAAATGTGCTGACTGTTCA
GAAGCCCTATGGTGGCTCCGGGCCACTTTACACTTGTGTGCCTGCTGGTAGTCCAGCATCCAGCTCGACGTTAGAAGGAA
AAAGGCCTGTGTCATATCAACACTTATCTAACAGCATGGCACAAAAGAGAAACTATGAGAATTTTATTGGGAATGCACAT
TATCGACCAAATGACAAAAAAACT

Protein (1048aa)

>JHU19872
MQSKVTGNMPTQSLLMYMDGPEVIGSSLGSPMEMEDALSMKGTAVVPFRATQEKNVIQIEGYMPLDCMFCSQTFTHSEDL
NKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTEPPKEKNCKENEFSCEVCGQTFRVAFDVEIHMRTHKDSFTYGCNM
CGRRFKEPWFLKNHMRTHNGKSGARSKLQQGLESSPATINEVVQVHAAESISSPYKICMVCGFLFPNKESLIEHRKVHTK
KTAFGTSSAQTDSPQGGMPSSREDFLQLFNLRPKSHPETGKKPVRCIPQLDPFTTFQAWQLATKGKVAICQEVKESGQEG
STDNDDSSSEKELGETNKGSCAGLSQEKEKCKHSHGEAPSVDADPKLPSSKEKPTHCSECGKAFRTYHQLVLHSRVHKKD
RRAGAESPTMSVDGRQPGTCSPDLAAPLDENGAVDRGEGGSEDGSEDGLPEGIHLDKNDDGGKIKHLTSSRECSYCGKFF
RSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHHKEKQTDVAAEVKNDGKNQDTEDALLTADSAQTKNLKRF
FDGAKDVTGSPPAKQLKEMPSVFQNVLGSAVLSPAHKDTQDFHKNAADDSADKVNKNPTPAYLDLLKKRSAVETQANNLI
CRTKADVTPPPDGSTTHNLEVSPKEKQTETAADCRYRPSVDCHEKPLNLSVGALHNCPAISLSKSLIPSITCPFCTFKTF
YPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAFPAQSKSLPSAKGKQSPPGPG
KAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSEMFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNING
SIDYPAKNDSPWAPPGRDYFCNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCV
YPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQHLSNSMAQKRNYENFIGNAH
YRPNDKKT