Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00229 GPER1 CEPR;CMKRL2;DRY12;GPER;GPR30 Homo sapiens Yes Cell Death; Kinases; Membrane Proteins; Nuclear Proteins; Signal Transduction; Transcription Factors

HuProt v2.0
Block Row Column Clone
17 1 7 JHU00229
17 1 8 JHU00229
HuProt v3.0
Block Row Column Clone
3 5 1 JHU00229
3 6 1 JHU00229
HuProt v3.1
Block Row Column Clone
3 5 1 JHU00229
3 6 1 JHU00229

External Database ID

Nucleotide (1128bp)

>JHU00229
ATGGATGTGACTTCCCAAGCCCGGGGCGTGGGCCTGGAGATGTACCTAGGCACCGCGCAGCCTGCGGCCCCCAACACCAC
CTCCCCCGAGCTCAACCTGTCCCACCCGCTCCTGGGCACCGCCCTGGCCAATGGGACAGGTGAGCTCTCGGAGCACCAGC
AGTACGTGATCGGCCTGTTCCTCTCGTGCCTCTACACCATCTTCCTCTTCCCCATCGGCTTTGTGGGCAACATCCTGATC
CTGGTGGTGAACATCAGCTTCCGCGAGAAGATGACCATCCCCGACCTGTACTTCATCAACCTGGCGGTGGCGGACCTCAT
CCTGGTGGCCGACTCCCTCATTGAGGTGTTCAACCTGCACGAGCGGTACTACGACATCGCCGTCCTGTGCACCTTCATGT
CGCTCTTCCTGCAGGTCAACATGTACAGCAGCGTCTTCTTCCTCACCTGGATGAGCTTCGACCGCTACATCGCCCTGGCC
AGGGCCATGCGCTGCAGCCTGTTCCGCACCAAGCACCACGCCCGGCTGAGCTGTGGCCTCATCTGGATGGCATCCGTGTC
AGCCACGCTGGTGCCCTTCACCGCCGTGCACCTGCAGCACACCGACGAGGCCTGCTTCTGTTTCGCGGATGTCCGGGAGG
TGCAGTGGCTCGAGGTCACGCTGGGCTTCATCGTGCCCTTCGCCATCATCGGCCTGTGCTACTCCCTCATTGTCCGGGTG
CTGGTCAGGGCGCACCGGCACCGTGGGCTGCGGCCCCGGCGGCAGAAGGCGCTCCGCATGATCCTCGCGGTGGTGCTGGT
CTTCTTCGTCTGCTGGCTGCCGGAGAACGTCTTCATCAGCGTGCACCTCCTGCAGCGGACGCAGCCTGGGGCCGCTCCCT
GCAAGCAGTCTTTCCGCCATGCCCACCCCCTCACGGGCCACATTGTCAACCTCGCCGCCTTCTCCAACAGCTGCCTAAAC
CCCCTCATCTACAGCTTTCTCGGGGAGACCTTCAGGGACAAGCTGAGGCTGTACATTGAGCAGAAAACAAATTTGCCGGC
CCTGAACCGCTTCTGTCACGCTGCCCTGAAGGCCGTCATTCCAGACAGCACTGAGCAGTCGGATGTGAGGTTCAGCAGTG
CCGTGTAG

Protein (375aa)

>JHU00229
MDVTSQARGVGLEMYLGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILI
LVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALA
RAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRV
LVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLN
PLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV