Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19847 SALL4 ZNF797 Homo sapiens No Nuclear Proteins; Signal Transduction; Transcription Factors

HuProt v2.0
Block Row Column Clone
39 23 27 JHU19847
39 23 28 JHU19847
29 23 25 JHU19847
29 23 26 JHU19847
HuProt v3.0
Block Row Column Clone
18 35 18 JHU19847
18 36 18 JHU19847
18 31 31 JHU19847
18 32 31 JHU19847
HuProt v3.1
Block Row Column Clone
18 35 18 JHU19847
18 36 18 JHU19847
18 31 31 JHU19847
18 32 31 JHU19847

External Database ID

Nucleotide (3159bp)

>JHU19847
ATGTCGAGGCGCAAGCAGGCGAAACCCCAGCACATCAACTCGGAGGAGGACCAGGGCGAGCAGCAGCCGCAGCAGCAGAC
CCCGGAGTTTGCAGATGCGGCCCCAGCGGCGCCCGCGGCGGGGGAGCTGGGTGCTCCAGTGAACCACCCAGGGAATGACG
AGGTGGCGAGTGAGGATGAAGCCACAGTAAAGCGGCTTCGTCGGGAGGAGACGCACGTCTGTGAGAAATGCTGTGCGGAG
TTCTTCAGCATCTCTGAGTTCCTGGAACATAAGAAAAATTGCACTAAAAATCCACCTGTCCTCATCATGAATGACAGCGA
GGGGCCTGTGCCTTCAGAAGACTTCTCCGGAGCTGTACTGAGCCACCAGCCCACCAGTCCCGGCAGTAAGGACTGTCACA
GGGAGAATGGCGGCAGCTCAGAGGACATGAAGGAGAAGCCGGATGCGGAGTCTGTGGTGTACCTAAAGACAGAGACAGCC
CTGCCACCCACCCCCCAGGACATAAGCTATTTAGCCAAAGGCAAAGTGGCCAACACTAACGTGACCTTGCAGGCACTACG
GGGCACCAAGGTGGCGGTGAATCAGCGGAGCGCGGATGCACTCCCTGCCCCCGTGCCTGGTGCCAACAGCATCCCGTGGG
TCCTCGAGCAGATCTTGTGTCTGCAGCAGCAGCAGCTACAGCAGATCCAGCTCACCGAGCAGATCCGCATCCAGGTGAAC
ATGTGGGCCTCCCACGCCCTCCACTCAAGCGGGGCAGGGGCCGACACTCTGAAGACCTTGGGCAGCCACATGTCTCAGCA
GGTTTCTGCAGCTGTGGCTTTGCTCAGCCAGAAAGCTGGAAGCCAAGGTCTGTCTCTGGATGCCTTGAAACAAGCCAAGC
TACCTCACGCCAACATCCCTTCTGCCACCAGCTCCCTGTCCCCAGGGCTGGCACCCTTCACTCTGAAGCCGGATGGGACC
CGGGTGCTCCCGAACGTCATGTCCCGCCTCCCGAGCGCTTTGCTTCCTCAGGCCCCGGGCTCGGTGCTCTTCCAGAGCCC
TTTCTCCACTGTGGCACTAGACACATCCAAGAAAGGGAAGGGGAAGCCACCGAACATCTCCGCGGTGGATGTCAAACCCA
AAGACGAGGCGGCCCTCTACAAGCACAAGTGTAAGTACTGTAGCAAGGTTTTTGGGACTGATAGCTCCTTGCAGATCCAC
CTCCGCTCCCACACTGGAGAGAGACCCTTCGTGTGCTCTGTCTGTGGTCATCGCTTCACCACCAAGGGCAACCTCAAGGT
GCACTTTCACCGACATCCCCAGGTGAAGGCAAACCCCCAGCTGTTTGCCGAGTTCCAGGACAAAGTGGCGGCCGGCAATG
GCATCCCCTATGCACTCTCTGTACCTGACCCCATAGATGAACCGAGTCTTTCTTTAGACAGCAAACCTGTCCTTGTAACC
ACCTCTGTAGGGCTACCTCAGAATCTTTCTTCGGGGACTAATCCCAAGGACCTCACGGGTGGCTCCTTGCCCGGTGACCT
GCAGCCTGGGCCTTCTCCAGAAAGTGAGGGTGGACCCACACTCCCTGGGGTGGGACCAAACTATAATTCCCCAAGGGCTG
GTGGCTTCCAAGGGAGTGGGACCCCTGAGCCAGGGTCAGAGACCCTGAAATTGCAGCAGTTGGTGGAGAACATTGACAAG
GCCACCACTGATCCCAACGAATGTCTCATTTGCCACCGAGTCTTAAGCTGTCAGAGCTCCCTCAAGATGCATTATCGCAC
CCACACCGGGGAGAGACCGTTCCAGTGTAAGATCTGTGGCCGAGCCTTTTCTACCAAAGGTAACCTGAAGACACACCTTG
GGGTTCACCGAACCAACACATCCATTAAGACGCAGCATTCGTGCCCCATCTGCCAGAAGAAGTTCACTAATGCCGTGATG
CTGCAGCAACATATTCGGATGCACATGGGCGGTCAGATTCCCAACACGCCCCTGCCAGAGAATCCCTGTGACTTTACGGG
TTCTGAGCCAATGACCGTGGGTGAGAACGGCAGCACCGGCGCTATCTGCCATGATGATGTCATCGAAAGCATCGATGTAG
AGGAAGTCAGCTCCCAGGAGGCTCCCAGCAGCTCCTCCAAGGTCCCCACGCCTCTTCCCAGCATCCACTCGGCATCACCC
ACGCTAGGGTTTGCCATGATGGCTTCCTTAGATGCCCCAGGGAAAGTGGGTCCTGCCCCTTTTAACCTGCAGCGCCAGGG
CAGCAGAGAAAACGGTTCCGTGGAGAGCGATGGCTTGACCAACGACTCATCCTCGCTGATGGGAGACCAGGAGTATCAGA
GCCGAAGCCCAGATATCCTGGAAACCACATCCTTCCAGGCACTCTCCCCGGCCAATAGTCAAGCCGAAAGCATCAAGTCA
AAGTCTCCCGATGCTGGGAGCAAAGCAGAGAGCTCCGAGAACAGCCGCACTGAGATGGAAGGTCGGAGCAGTCTCCCTTC
CACGTTTATCCGAGCCCCGCCGACCTATGTCAAGGTTGAAGTTCCTGGCACATTTGTGGGACCCTCGACATTGTCCCCAG
GGATGACCCCTTTGTTAGCAGCCCAGCCACGCCGACAGGCCAAGCAACATGGCTGCACACGGTGTGGGAAGAACTTCTCC
TCTGCTAGCGCTCTTCAGATCCACGAGCGGACTCACACTGGAGAGAAGCCTTTTGTGTGCAACATTTGTGGGCGAGCTTT
TACCACCAAAGGCAACTTAAAGGTTCACTACATGACACACGGGGCGAACAATAACTCAGCCCGCCGTGGAAGGAAGTTGG
CCATCGAGAACACCATGGCTCTGTTAGGTACGGACGGAAAAAGAGTCTCAGAAATCTTTCCCAAGGAAATCCTGGCCCCT
TCAGTGAATGTGGACCCTGTTGTGTGGAACCAGTACACCAGCATGCTCAATGGCGGTCTGGCCGTGAAGACCAATGAGAT
CTCTGTGATCCAGAGTGGGGGGGTTCCTACCCTCCCGGTTTCCTTGGGGGCCACCTCCGTTGTGAATAACGCCACTGTCT
CCAAGATGGATGGCTCCCAGTCGGGTATCAGTGCAGATGTGGAAAAACCAAGTGCTACTGACGGCGTTCCCAAACACCAG
TTTCCTCACTTCCTGGAAGAAAACAAGATTGCGGTCAGC

Protein (1053aa)

>JHU19847
MSRRKQAKPQHINSEEDQGEQQPQQQTPEFADAAPAAPAAGELGAPVNHPGNDEVASEDEATVKRLRREETHVCEKCCAE
FFSISEFLEHKKNCTKNPPVLIMNDSEGPVPSEDFSGAVLSHQPTSPGSKDCHRENGGSSEDMKEKPDAESVVYLKTETA
LPPTPQDISYLAKGKVANTNVTLQALRGTKVAVNQRSADALPAPVPGANSIPWVLEQILCLQQQQLQQIQLTEQIRIQVN
MWASHALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKAGSQGLSLDALKQAKLPHANIPSATSSLSPGLAPFTLKPDGT
RVLPNVMSRLPSALLPQAPGSVLFQSPFSTVALDTSKKGKGKPPNISAVDVKPKDEAALYKHKCKYCSKVFGTDSSLQIH
LRSHTGERPFVCSVCGHRFTTKGNLKVHFHRHPQVKANPQLFAEFQDKVAAGNGIPYALSVPDPIDEPSLSLDSKPVLVT
TSVGLPQNLSSGTNPKDLTGGSLPGDLQPGPSPESEGGPTLPGVGPNYNSPRAGGFQGSGTPEPGSETLKLQQLVENIDK
ATTDPNECLICHRVLSCQSSLKMHYRTHTGERPFQCKICGRAFSTKGNLKTHLGVHRTNTSIKTQHSCPICQKKFTNAVM
LQQHIRMHMGGQIPNTPLPENPCDFTGSEPMTVGENGSTGAICHDDVIESIDVEEVSSQEAPSSSSKVPTPLPSIHSASP
TLGFAMMASLDAPGKVGPAPFNLQRQGSRENGSVESDGLTNDSSSLMGDQEYQSRSPDILETTSFQALSPANSQAESIKS
KSPDAGSKAESSENSRTEMEGRSSLPSTFIRAPPTYVKVEVPGTFVGPSTLSPGMTPLLAAQPRRQAKQHGCTRCGKNFS
SASALQIHERTHTGEKPFVCNICGRAFTTKGNLKVHYMTHGANNNSARRGRKLAIENTMALLGTDGKRVSEIFPKEILAP
SVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQ
FPHFLEENKIAVS