Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19838 Prdm16 Mus musculus No

HuProt v2.0
Block Row Column Clone
31 23 29 JHU19838
31 23 30 JHU19838
HuProt v3.0
Block Row Column Clone
17 31 28 JHU19838
17 32 28 JHU19838
HuProt v3.1
Block Row Column Clone
17 31 28 JHU19838
17 32 28 JHU19838

External Database ID
  • Reviewed UniProt: A2A935-2 (PRD16_MOUSE)

Nucleotide (3534bp)

>JHU19838
ATGCGATCCAAGGCGAGGGCGAGGAAGCTAGCCAAAAGTGACGGTGACGTTGTAAATAATATGTATGAACCTGACCCGGA
CCTGCTGGCCGGCCAGAGTGCCGAGGAGGAGACCGAAGACGGCATCCTGTCCCCCATCCCCATGGGGCCACCGTCCCCCT
TCCCCACCAGCGAGGACTTCACTCCCAAGGAGGGCTCGCCCTATGAGGCTCCTGTCTACATTCCTGAAGACATTCCAATC
CCACCAGACTTCGAGCTACGAGAGTCCTCCATACCAGGAGCTGGCCTGGGGATCTGGGCCAAGCGGAAGATGGAAATCGG
GGAGAGGTTTGGCCCCTACGTGGTGACGCCCCGGGCCGCACTGAAGGAGGCCGACTTTGGATGGGAGCAGATGCTGACGG
ATACAGAGGTGTCATCCCAGGAGAGCTGCATCAAAAAGCAGATCTCTGAAGACTTGGGTAGCGAGAAGTTCTGCGTGGAT
GCCAATCAGGCGGGGTCTGGCAGCTGGCTCAAGTACATCCGTGTAGCGTGTTCCTGTGATGACCAAAACCTCGCCATGTG
TCAGATCAACGAACAGATTTACTATAAAGTCATTAAGGACATCGAGCCTGGAGAGGAACTGTTGGTGCATGTGAAAGAAG
GTGCCTACTCCTTGGGTGTCATGGCCCCCAGCTTGGATGAGGACCCCACATTCCGCTGTGATGAGTGTGATGAGCTCTTC
CAGTGCAGGCTGGACCTGAGGCGCCACAAGAAGTACGCGTGCAGCTCTGCAGGAGCCCAGCTCTACGAGGGCCTAGGGGA
GGAACTCAAGCCCGAGGGCCTTGGCGTGGGCAGCGACGGGCAAGCGCATGAGTGCAAGGATTGCGAGCGGATGTTCCCCA
ACAAGTACAGCTTGGAGCAACACATGATCGTCCACACGGAAGAGCGTGAGTACAAATGTGACCAGTGTCCCAAGGCCTTC
AACTGGAAGTCCAACCTCATCCGCCACCAGATGTCTCACGACAGTGGCAAGCGCTTCGAATGTGAAAACTGTGTCAAGGT
GTTCACGGACCCCAGCAACCTCCAGCGTCACATCCGCTCACAGCATGTCGGTGCCCGGGCCCATGCCTGCCCTGACTGTG
GCAAGACCTTCGCCACATCCTCTGGCCTCAAACAGCACAAGCATATCCACAGCACGGTGAAGCCATTCATATGCGAGGTC
TGCCACAAGTCCTACACGCAGTTCTCCAACCTGTGCCGGCACAAGCGGATGCACGCCGACTGCAGGACGCAGATCAAGTG
CAAGGACTGTGGGCAGATGTTCAGCACTACCTCCTCCCTCAACAAGCATCGGAGATTCTGCGAGGGCAAGAACCATTACA
CGCCTGGCAGCATCTTCACCCCAGGCCTGCCCTTGACCCCCAGCCCCATGATGGACAAGACAAAACCCTCCCCGACCCTC
AACCACGGGGGCCTAGGCTTCAGCGAGTACTTCCCCTCCAGACCTCATCCTGGGAGCCTGCCCTTCTCGGCTGCTCCTCC
GGCCTTCCCCGCACTCACTCCGGGCTTCCCGGGCATCTTTCCTCCATCCCTGTACCCACGACCACCTCTGCTACCTCCCA
CGCCGCTGCTCAAGAGCCCCCTGAACCACGCGCAGGACGCCAAGCTACCCAGCCCGCTGGGAAACCCAGCCCTGCCCCTT
GTCTCCGCGGTCAGCAATAGCAGCCAGGGTGCCACAGCGGCCACCGGGTCAGAGGAGAAATTTGATGGCCGCTTGGAAGA
CGCATATGCGGAGAAGGTCAAAAATAGGAGCCCTGACATGTCGGATGGCAGTGACTTTGAGGATATCAACACCACGACCG
GGACAGACTTGGACACTACCACGGGCACGGGGTCAGACCTGGACAGCGACCTGGACAGTGACAGAGACAAAGGCAAGGAC
AAGGGGAAGCCAGTGGAGAGCAAACCTGAGTTTGGGGGTGCATCTGTGCCCCCTGGGGCCATGAACAGTGTGGCCGAGGT
ACCGGCCTTCTACTCACAGCATTCCTTCTTCCCGCCACCCGAGGAACAGCTGCTGACGGCCTCGGGAGCTGCCGGCGACT
CCATCAAGGCCATCGCGTCCATCGCGGAGAAATACTTCGGTCCTGGCTTCATGAGCATGCAGGAGAAGAAGCTGGGCTCA
CTACCCTACCACTCCGTGTTCCCCTTCCAGTTCCTGCCTAACTTTCCCCACTCCCTCTACCCCTTTACGGACCGAGCCCT
CGCCCACAACTTGCTGGTCAAGGCTGAGCCAAAGTCACCCCGGGATGCCCTCAAGGTGGGCGGCCCCAGTGCGGAGTGCC
CCTTCGACCTCACCACCAAACCAAAAGAGGCCAAACCCGCCCTGCTCGCACCCAAGGTCCCCCTCATCCCCTCATCTGGC
GAGGAACAGCCACTGGACCTGAGCATCGGCAGCAGGGCCAGGGCAAGCCAGAACGGAGGTGGCCGTGAGCCGCGGAAGAA
CCACGTCTACGGTGAACGGAAGCCGGGGGTCAGCGAGGGGCTGCCTAAGGTGTGCCCAGCACAGCTGCCCCAGCAGCCCT
CCTTGCATTATGCTAAGCCTTCACCGTTCTTCATGGATCCCATCTACAGCAGGGTAGAAAAGCGGAAGGTGGCAGACCCT
GTGGGAGTCCTGAAAGAGAAGTACCTGCGGCCGTCCCCACTTCTGTTCCACCCCCAGATGTCAGCCATAGAAACCATGAC
GGAGAAGCTGGAGAGCTTTGCAGCCATGAAGGCCGACTCAGGCAGCTCCCTGCAGCCCCTGCCTCACCACCCGTTCAACT
TCCGCTCCCCACCCCCAACGCTCTCGGATCCCATCCTCAGGAAGGGGAAGGAGAGATACACGTGCAGGTACTGTGGCAAG
ATCTTCCCCAGATCTGCAAATCTCACAAGACATCTGAGGACACACACAGGGGAGCAGCCATACAGGTGCAAGTACTGTGA
CCGGTCATTCAGCATCTCCTCCAACCTCCAGCGGCACGTGAGGAACATCCACAACAAAGAGAAGCCGTTCAAGTGCCATC
TGTGCAACCGCTGCTTCGGGCAGCAGACCAACCTAGACCGGCACCTGAAGAAGCACGAACACGAGGGCGCACCAGTGAGC
CAGCACTCCGGGGTGCTCACGAACCACCTGGGCACCAGCGCCTCCTCCCCCACCTCCGAGTCGGACAACCATGCACTTTT
AGATGAGAAGGAAGATTCTTACTTCTCCGAGATCCGAAACTTCATCGCCAACAGCGAGATGAACCAGGCATCCACTCGAA
TGGACAAACGGCCTGAGATCCAAGACCTGGACAGCAACCCACCGTGTCCAGGCTCAGCCAGTGCAAAGCCAGAGGACGTA
GAGGAGGAGGAAGAGGAGGAGCTGGAGGAAGAGGATGATGACAGCTTAGCCGGGAAGTCACAGGAGGACACGGTGTCCCC
CACACCTGAGCCCCAAGGAGTCTATGAAGATGAAGAGGATGAGGAACCACCCAGCCTGACCATGGGCTTTGACCATACCC
GGAGGCATATGCAA

Protein (1178aa)

>JHU19838
MRSKARARKLAKSDGDVVNNMYEPDPDLLAGQSAEEETEDGILSPIPMGPPSPFPTSEDFTPKEGSPYEAPVYIPEDIPI
PPDFELRESSIPGAGLGIWAKRKMEIGERFGPYVVTPRAALKEADFGWEQMLTDTEVSSQESCIKKQISEDLGSEKFCVD
ANQAGSGSWLKYIRVACSCDDQNLAMCQINEQIYYKVIKDIEPGEELLVHVKEGAYSLGVMAPSLDEDPTFRCDECDELF
QCRLDLRRHKKYACSSAGAQLYEGLGEELKPEGLGVGSDGQAHECKDCERMFPNKYSLEQHMIVHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEV
CHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGSIFTPGLPLTPSPMMDKTKPSPTL
NHGGLGFSEYFPSRPHPGSLPFSAAPPAFPALTPGFPGIFPPSLYPRPPLLPPTPLLKSPLNHAQDAKLPSPLGNPALPL
VSAVSNSSQGATAATGSEEKFDGRLEDAYAEKVKNRSPDMSDGSDFEDINTTTGTDLDTTTGTGSDLDSDLDSDRDKGKD
KGKPVESKPEFGGASVPPGAMNSVAEVPAFYSQHSFFPPPEEQLLTASGAAGDSIKAIASIAEKYFGPGFMSMQEKKLGS
LPYHSVFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPSAECPFDLTTKPKEAKPALLAPKVPLIPSSG
EEQPLDLSIGSRARASQNGGGREPRKNHVYGERKPGVSEGLPKVCPAQLPQQPSLHYAKPSPFFMDPIYSRVEKRKVADP
VGVLKEKYLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTCRYCGK
IFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHEGAPVS
QHSGVLTNHLGTSASSPTSESDNHALLDEKEDSYFSEIRNFIANSEMNQASTRMDKRPEIQDLDSNPPCPGSASAKPEDV
EEEEEEELEEEDDDSLAGKSQEDTVSPTPEPQGVYEDEEDEEPPSLTMGFDHTRRHMQ