Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19836 PIWIL2 HILI Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (2919bp)

>JHU19836
ATGGATCCTTTCCGACCATCGTTCAGGGGCCAGTCTCCTATCCACCCATCCCAGTGCCAGGCTGTACGGATGCCAGGCTG
TTGGCCACAAGCTTCTAAACCTTTGGACCCAGCTCTGGGCAGGGGAGCACCTGCAGGCAGAGGCCATGTATTTGGAAAGC
CAGAGGAACCAAGCACACAGAGGGGGCCAGCACAAAGGGAGTCTGTGGGTTTGGTCTCCATGTTCCGAGGCCTGGGCATT
GAAACAGTTTCTAAGACCCCTCTGAAACGGGAAATGCTTCCATCAGGTAGAGGCATTTTAGGTCGAGGCTTGTCTGCTAA
TCTGGTACGCAAGGACAGGGAGGAACTCTCTCCCACTTTTTGGGATCCAAAAGTGTTGGCGGCTGGGGACAGCAAGATGG
CAGAGACCTCCGTTGGTTGGAGTAGGACGCTTGGAAGAGGGAGTTCAGATGCGTCTTTATTACCACTGGGAAGAGCAGCA
GGTGGTATCAGCAGAGAAGTGGACAAGCCTCCCTGTACCTTCAGCACACCGTCCCGGGGTCCCCCGCAGCTGTCATCACC
ACCAGCTCTGCCCCAGTCTCCCCTGCACTCTCCAGATCGCCCTCTGGTCCTGACTGTGGAACACAAGGAAAAAGAGCTTA
TTGTGAAGCAAGGATCAAAAGGAACACCTCAGTCTTTGGGACTGAACCTCGTCAAAATACAGTGTCATAATGAAGCAGTT
TATCAATATCATGTGACTTTCAGCCCCAATGTGGAGTGCAAAAGCATGAGGTTCGGCATGTTGAAGGACCATCAAGCTGT
CACCGGCAACGTCACTGCGTTTGATGGATCTATTCTCTATCTGCCTGTTAAGCTTCAACAAGTTCTTGAGTTAAAAAGTC
AAAGGAAAACAGACAGTGCTGAAATCAGCATTAAGATTCAGATGACAAAGATCCTGGAGCCCTGCTCTGACCTGTGCATT
CCCTTCTACAATGTTGTTTTCCGTCGGGTAATGAAACTTTTAGATATGAAGCTTGTGGGGAGAAACTTTTATGACCCTAC
AAGTGCTATGGTACTACAGCAACACAGATTGCAGATCTGGCCAGGCTATGCAGCTAGCATCCGAAGGACAGATGGAGGGC
TCTTCCTGCTAGCTGATGTCTCCCATAAGGTCATTCGGAATGACTGTGTGCTGGATGTCATGCATGCCATTTATCAGCAG
AATAAAGAACACTTCCAGGATGAGTGTACTAAGCTTCTGGTTGGCAATATTGTTATCACCCGATATAACAATCGTACCTA
TCGTATTGATGATGTGGATTGGAATAAGACTCCAAAGGATAGCTTCACGATGTCTGATGGGAAAGAGATCACATTCTTGG
AATACTACAGCAAAAATTATGGGATCACAGTTAAGGAAGAGGACCAGCCATTGCTGATTCACAGGCCCAGTGAGAGACAG
GATAATCATGGGATGCTGCTAAAAGGGGAAATCCTGCTGCTGCCTGAGCTTTCTTTTATGACCGGAATCCCAGAGAAGAT
GAAGAAGGACTTCAGAGCCATGAAGGATTTGGCTCAGCAAATCAATCTGAGCCCCAAGCAACACCATAGTGCTTTGGAAT
GCTTGCTGCAAAGAATTGCAAAGAACGAGGCAGCCACCAATGAACTGATGCGTTGGGGGCTCCGTCTGCAAAAGGATGTA
CATAAGATTGAAGGACGTGTTCTGCCAATGGAAAGAATTAACTTAAAAAATACTTCGTTTATCACATCTCAGGAACTAAA
CTGGGTTAAGGAAGTAACCAGAGACCCTTCCATCTTGACTATCCCCATGCATTTCTGGGCACTTTTTTACCCAAAGAGAG
CAATGGACCAGGCTCGAGAACTGGTCAACATGTTGGAGAAGATAGCCGGCCCCATTGGCATGCGTATGAGCCCACCGGCC
TGGGTTGAACTAAAGGATGACCGAATAGAGACTTATGTCAGAACCATTCAATCCACGTTAGGAGCTGAGGGGAAGATACA
GATGGTTGTTTGCATCATCATGGGCCCACGTGATGATCTCTATGGGGCCATCAAGAAGCTGTGCTGTGTGCAGTCCCCAG
TGCCCTCCCAGGTTGTCAATGTTCGAACCATTGGTCAGCCCACCAGGCTTCGGAGTGTGGCCCAGAAGATTTTACTTCAG
ATTAACTGTAAATTGGGTGGTGAGCTCTGGGGAGTGGATATTCCTCTGAAACAGTTAATGGTGATCGGGATGGATGTTTA
CCATGACCCCAGTAGAGGCATGCGCTCCGTGGTTGGCTTCGTGGCAAGCATCAATCTCACCCTCACAAAATGGTATTCCC
GGGTGGTGTTCCAGATGCCGCATCAGGAGATTGTGGACAGCCTGAAGCTATGCCTCGTGGGCTCCTTAAAAAAGTTTTAT
GAGGTGAACCACTGTCTACCAGAGAAGATTGTGGTGTACCGTGATGGAGTGTCTGATGGCCAACTGAAGACAGTTGCCAA
CTATGAGATTCCTCAACTACAGAAGTGTTTTGAAGCTTTTGAGAATTATCAGCCCAAGATGGTGGTGTTTGTAGTTCAGA
AGAAAATCAGTACTAATCTATATCTGGCTGCTCCTCAGAACTTTGTAACTCCCACTCCTGGAACTGTGGTAGATCATACA
ATAACAAGCTGTGAGTGGGTGGATTTCTATCTTCTTGCCCATCATGTACGGCAGGGCTGTGGCATTCCTACGCATTATGT
CTGTGTTCTCAACACCGCAAACCTGAGCCCTGATCATATGCAGAGGCTGACTTTCAAACTGTGCCACATGTACTGGAATT
GGCCTGGCACCATCAGAGTTCCAGCTCCTTGCAAGTATGCCCACAAGCTAGCTTTCCTGTCAGGACACATCTTGCATCAT
GAACCAGCCATCCAGCTGTGCGAGAACCTGTTCTTCCTG

Protein (973aa)

>JHU19836
MDPFRPSFRGQSPIHPSQCQAVRMPGCWPQASKPLDPALGRGAPAGRGHVFGKPEEPSTQRGPAQRESVGLVSMFRGLGI
ETVSKTPLKREMLPSGRGILGRGLSANLVRKDREELSPTFWDPKVLAAGDSKMAETSVGWSRTLGRGSSDASLLPLGRAA
GGISREVDKPPCTFSTPSRGPPQLSSPPALPQSPLHSPDRPLVLTVEHKEKELIVKQGSKGTPQSLGLNLVKIQCHNEAV
YQYHVTFSPNVECKSMRFGMLKDHQAVTGNVTAFDGSILYLPVKLQQVLELKSQRKTDSAEISIKIQMTKILEPCSDLCI
PFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIWPGYAASIRRTDGGLFLLADVSHKVIRNDCVLDVMHAIYQQ
NKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQ
DNHGMLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIAKNEAATNELMRWGLRLQKDV
HKIEGRVLPMERINLKNTSFITSQELNWVKEVTRDPSILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRMSPPA
WVELKDDRIETYVRTIQSTLGAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVRTIGQPTRLRSVAQKILLQ
INCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKFY
EVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFENYQPKMVVFVVQKKISTNLYLAAPQNFVTPTPGTVVDHT
ITSCEWVDFYLLAHHVRQGCGIPTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHH
EPAIQLCENLFFL