Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19829 MTF1 Homo sapiens No Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
31 23 21 JHU19829
31 23 22 JHU19829
HuProt v3.0
Block Row Column Clone
19 31 28 JHU19829
19 32 28 JHU19829
HuProt v3.1
Block Row Column Clone
19 31 28 JHU19829
19 32 28 JHU19829

External Database ID

Nucleotide (2259bp)

>JHU19829
ATGGGGGAACACAGTCCAGACAACAACATCATCTACTTTGAGGCAGAGGAAGATGAGCTGACCCCCGATGATAAAATGCT
CAGGTTTGTGGATAAAAACGGACTGGTGCCTTCCTCATCTGGAACTGTTTATGATAGGACCACTGTTCTTATTGAGCAGG
ACCCTGGCACTTTGGAGGATGAAGATGACGACGGACAGTGCGGAGAACACTTGCCTTTTCTAGTAGGGGGTGAAGAGGGC
TTTCACCTGATAGATCATGAAGCAATGTCCCAGGGTTATGTGCAGCACATTATCTCACCAGATCAGATTCATTTGACAAT
AAACCCTGGTTCCACACCCATGCCAAGAAATATTGAAGGTGCAACCCTCACTCTGCAGTCGGAATGTCCGGAAACAAAAC
GTAAAGAAGTAAAGCGGTACCAATGTACCTTTGAGGGCTGTCCCCGCACCTACAGCACAGCAGGCAACCTGCGAACCCAC
CAGAAGACTCACCGAGGAGAGTACACCTTTGTCTGTAATCAGGAGGGCTGTGGCAAAGCCTTCCTTACCTCTTACAGCCT
CAGGATCCACGTGCGAGTGCACACGAAGGAGAAGCCATTTGAGTGTGACGTGCAGGGCTGTGAGAAGGCATTCAACACAC
TGTACAGGCTGAAAGCACATCAGAGGCTTCACACAGGGAAAACGTTTAACTGTGAATCTGAAGGCTGCAGCAAATACTTC
ACCACACTCAGTGATCTGAGGAAGCACATTCGAACTCATACAGGGGAAAAGCCATTTCGGTGCGATCACGATGGCTGTGG
AAAAGCATTTGCAGCAAGCCACCACCTTAAAACTCACGTTCGTACACATACTGGTGAAAGACCCTTCTTCTGCCCCAGTA
ATGGCTGTGAGAAAACATTCAGCACTCAATACAGTCTCAAAAGTCACATGAAAGGTCATGATAACAAAGGACACTCATAC
AATGCACTTCCACAACACAATGGATCAGAGGATACAAATCACTCACTTTGTCTAAGTGACTTGAGCCTTCTGTCCACAGA
TTCTGAATTGCGAGAAAATTCCAGTACGACCCAGGGCCAGGACCTCAGCACAATTTCACCAGCAATCATCTTTGAATCAA
TGTTCCAGAATTCAGATGATACGGCAATTCAGGAAGATCCTCAACAGACGGCTTCCTTGACTGAAAGTTTTAATGGTGAT
GCAGAGTCAGTCAGTGATGTTCCGCCATCCACAGGAAATTCAGCATCTTTATCTCTTCCACTTGTACTGCAACCTGGCCT
CTCCGAGCCACCCCAGCCTCTACTACCTGCCTCAGCTCCGTCTGCTCCTCCGCCTGCTCCCTCCCTAGGACCTGGCTCCC
AGCAAGCTGCATTTGGCAACCCCCCTGCTCTCTTACAACCTCCAGAAGTGCCTGTTCCCCACAGCACACAGTTTGCTGCT
AATCATCAAGAGTTTCTTCCGCACCCCCAGGCACCGCAGCCCATTGTACCAGGACTTTCTGTTGTTGCTGGGGCTTCTGC
ATCAGCAGCGGCAGTGGCATCAGCTGTGGCAGCACCAGCCCCACCACAAAGTACTACTGAGCCCCTGCCAGCCATGGTCC
AGACTCTGCCCCTGGGTGCCAACTCTGTCCTAACTAATAATCCCACAATAACCATCACCCCAACTCCCAACACAGCTATC
CTGCAGTCCAGCCTAGTCATGGGAGAACAGAACTTACAATGGATATTAAATGGTGCCACCAGTTCTCCACAAAACCAAGA
ACAAATTCAGCAAGCATCTAAAGTTGAGAAGGTGTTTTTTACCACTGCAGTACCAGTAGCCAGTAGCCCAGGGAGCTCTG
TCCAGCAGATTGGCCTCAGTGTTCCTGTGATCATCATCAAACAAGAAGAGGCATGTCAGTGTCAGTGTGCATGCCGGGAC
TCTGCAAAGGAGCGGGCATCCAGCAGGAGAAAGGGCTGCTCCTCCCCACCCCCTCCAGAGCCGAGCCCCCAGGCTCCTGA
TGGGCCCAGCCTGCAGCTCCCAGCGCAGACTTTCTCTTCAGCCCCTGTTCCCGGGTCATCATCCTCTACCTTGCCCTCCT
CCTGTGAGCAAAGCCGACAAGCAGAGACTCCTTCAGACCCTCAGACAGAAACATTAAGTGCCATGGATGTGTCAGAGTTT
CTATCCCTCCAGAGCCTGGACACCCCGTCCAATCTGATTCCCATTGAAGCACTACTGCAGGGGGAGGAGGAGATGGGCCT
CACCAGCAGCTTCTCCAAG

Protein (753aa)

>JHU19829
MGEHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLEDEDDDGQCGEHLPFLVGGEEG
FHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRYQCTFEGCPRTYSTAGNLRTH
QKTHRGEYTFVCNQEGCGKAFLTSYSLRIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCSKYF
TTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGERPFFCPSNGCEKTFSTQYSLKSHMKGHDNKGHSY
NALPQHNGSEDTNHSLCLSDLSLLSTDSELRENSSTTQGQDLSTISPAIIFESMFQNSDDTAIQEDPQQTASLTESFNGD
AESVSDVPPSTGNSASLSLPLVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAA
NHQEFLPHPQAPQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGANSVLTNNPTITITPTPNTAI
LQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPGSSVQQIGLSVPVIIIKQEEACQCQCACRD
SAKERASSRRKGCSSPPPPEPSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSRQAETPSDPQTETLSAMDVSEF
LSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK