Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19787 ZNF300 Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (1812bp)

>JHU19787
ATGATGAAGTCCCAGGGGTTAGTATCATTCAAGGATGTGGCTGTGGATTTCACCCAGGAGGAGTGGCAGCAACTTGACCC
TTCTCAGAGGACCCTGTACAGGGATGTGATGCTGGAGAACTACAGCCACCTGGTCTCAATGGGGTATCCAGTTTCCAAAC
CAGATGTCATCTCCAAGTTGGAACAAGGAGAAGAGCCATGGATCATAAAGGGAGACATATCAAATTGGATCTATCCAGAT
GAATATCAGGCAGATGGGAGACAAGACAGGAAGAGTAACCTTCACAACTCCCAGTCATGTATTTTGGGGACAGTTTCCTT
CCATCATAAGATACTGAAAGGAGTCACAAGGGATGGTTCATTGTGCTCCATTTTAAAAGTCTGTCAAGGTGATGGTCAGC
TGCAGAGATTTCTAGAGAATCAAGACAAACTCTTCAGGCAGGTCACATTTGTTAACAGCAAAACAGTGACTGAGGCATCA
GGGCATAAATATAATCCACTGGGGAAAATATTTCAAGAGTGCATAGAAACAGATATATCAATACAGAGATTCCATAAATA
TGATGCTTTTAAAAAGAACTTAAAACCAAATATTGACCTACCGAGTTGTTATAAGAGCAATTCAAGAAAAAAACCTGATC
AGAGTTTTGGAGGTGGAAAATCATCTAGCCAGAGTGAGCCCAATTCTAATCTTGAGAAGATTCACAATGGAGTAATACCT
TTTGATGATAATCAGTGTGGAAACGTTTTTAGAAATACACAATCCCTTATTCAATATCAGAATGTGGAAACTAAAGAGAA
AAGCTGTGTATGTGTTACATGTGGAAAAGCCTTTGCTAAGAAGTCACAACTCATTGTACATCAAAGAATTCATACTGGAA
AGAAACCATATGATTGTGGTGCATGCGGAAAAGCCTTCAGTGAGAAGTTTCATCTTGTTGTACATCAGAGAACTCATACT
GGGGAGAAACCTTATGATTGTTCTGAATGTGGAAAAGCCTTCTCTCAGAAATCGTCCCTTATTATACATCAGAGAGTTCA
CACTGGGGAAAAACCCTATGAATGTAGTGAATGCGGGAAAGCCTTCTCCCAGAAATCACCCCTCATTATACATCAGAGAA
TACATACTGGGGAAAAACCCTATGAATGTAGAGAGTGTGGGAAGGCCTTTTCCCAGAAGTCACAGCTGATTATACACCAC
AGAGCTCATACTGGAGAGAAGCCGTATGAGTGTACCGAATGTGGGAAAGCCTTCTGTGAGAAGTCCCACCTCATTATACA
TAAAAGAATTCACACTGGTGAGAAACCCTACAAATGTGCTCAATGTGAGGAAGCCTTCAGCAGGAAGACAGAACTCATTA
CACATCAGTTAGTTCATACTGGGGAAAAACCTTATGAATGTACTGAATGTGGAAAGACATTCTCCCGCAAGTCACAGCTC
ATCATACATCAGAGAACACATACTGGAGAAAAACCCTATAAATGTAGTGAATGTGGCAAAGCCTTCTGCCAGAAGTCACA
TCTCATTGGACATCAGAGAATTCACACAGGAGAAAAACCTTATATATGTACTGAATGTGGGAAAGCCTTCTCTCAGAAGT
CCCACCTTCCGGGACACCAGCGAATTCATACAGGAGAGAAACCTTACATATGTGCTGAATGTGGAAAGGCCTTTTCTCAG
AAGTCAGACCTTGTTTTACATCAGAGGATTCATACTGGGGAAAGACCCTATCAATGTGCTATATGTGGGAAGGCCTTCAT
CCAGAAGTCACAACTAACTGTACACCAGAGAATTCACACAGTGGTAAAATCA

Protein (604aa)

>JHU19787
MMKSQGLVSFKDVAVDFTQEEWQQLDPSQRTLYRDVMLENYSHLVSMGYPVSKPDVISKLEQGEEPWIIKGDISNWIYPD
EYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSLCSILKVCQGDGQLQRFLENQDKLFRQVTFVNSKTVTEAS
GHKYNPLGKIFQECIETDISIQRFHKYDAFKKNLKPNIDLPSCYKSNSRKKPDQSFGGGKSSSQSEPNSNLEKIHNGVIP
FDDNQCGNVFRNTQSLIQYQNVETKEKSCVCVTCGKAFAKKSQLIVHQRIHTGKKPYDCGACGKAFSEKFHLVVHQRTHT
GEKPYDCSECGKAFSQKSSLIIHQRVHTGEKPYECSECGKAFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHH
RAHTGEKPYECTECGKAFCEKSHLIIHKRIHTGEKPYKCAQCEEAFSRKTELITHQLVHTGEKPYECTECGKTFSRKSQL
IIHQRTHTGEKPYKCSECGKAFCQKSHLIGHQRIHTGEKPYICTECGKAFSQKSHLPGHQRIHTGEKPYICAECGKAFSQ
KSDLVLHQRIHTGERPYQCAICGKAFIQKSQLTVHQRIHTVVKS