Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19786 ZNF264 KIAA0412 Homo sapiens No Nuclear Proteins

HuProt v2.0
Block Row Column Clone
9 23 29 JHU19786
9 23 30 JHU19786
HuProt v3.0
Block Row Column Clone
17 31 11 JHU19786
17 32 11 JHU19786
HuProt v3.1
Block Row Column Clone
17 31 11 JHU19786
17 32 11 JHU19786

External Database ID

Nucleotide (1881bp)

>JHU19786
ATGGCGGCAGCGGTGCTGACGGACCGGGCCCAGGTGTCTGTGACCTTTGATGATGTGGCTGTGACTTTCACCAAGGAGGA
GTGGGGGCAGCTGGACCTAGCTCAGCGGACCCTGTACCAGGAGGTGATGCTGGAAAACTGTGGGCTCCTGGTGTCTCTGG
GGTGTCCTGTTCCCAAAGCTGAGCTGATCTGCCACCTAGAGCATGGGCAGGAGCCATGGACCAGGAAGGAAGACCTCTCC
CAAGACACCTGTCCAGGCGACAAAGGAAAACCTAAGACCACAGAACCTACCACTTGTGAGCCAGCCTTGTCAGAGGGAAT
CTCACTTCAGGGACAAGTGACACAAGGAAACTCAGTGGACTCACAGTTGGGGCAAGCCGAGGATCAGGATGGGCTATCAG
AAATGCAGGAAGGACACTTCAGACCAGGAATAGATCCCCAGGAGAAGTCTCCTGGGAAGATGAGCCCTGAATGTGATGGT
TTAGGGACAGCTGATGGTGTGTGTTCAAGGATTGGACAGGAGCAAGTCTCTCCAGGAGATACAGTCCATAGCCATAACTC
ATGTGAGTCAGGTAAAGATCCCATGATTCAGGAAGAGGAAAATAACTTTAAATGCAGTGAATGTGGAAAAGTATTTAACA
AGAAACACCTCCTTGCTGGACATGAGAAAATTCACTCTGGAGTTAAGCCCTATGAATGCACAGAATGTGGGAAAACCTTT
ATTAAGAGCACACATCTCCTGCAACATCACATGATCCACACTGGGGAGAGGCCCTATGAGTGCATGGAGTGTGGAAAGGC
CTTCAACCGCAAGTCATACCTTACCCAGCACCAGCGGATTCACAGTGGAGAGAAGCCTTACAAGTGCAATGAATGCGGAA
AGGCCTTCACCCACCGCTCCAATTTTGTCTTGCATAACAGGAGACACACTGGAGAAAAATCCTTTGTGTGCACAGAATGT
GGCCAAGTCTTTCGACATAGGCCAGGCTTTCTCCGGCACTATGTTGTCCACAGTGGTGAGAATCCCTATGAGTGCTTGGA
GTGTGGCAAGGTCTTCAAACACAGGTCATATCTCATGTGGCACCAGCAGACTCATACCGGGGAGAAGCCCTATGAGTGCA
GTGAATGTGGGAAGGTCTTCTTGGAGAGTGCAGCCCTGATTCACCACTATGTCATCCACACTGGAGAGAAGCCCTTTGAG
TGCCTCGAGTGTGGGAAGGCTTTCAACCACCGATCCTACCTCAAGAGGCACCAGCGGATTCACACTGGGGAGAAGCCCTT
CGTGTGCAGTGAATGTGGAAAGGCCTTCACCCACTGCTCTACTTTTATCTTGCATAAAAGGGCCCACACTGGAGAAAAGC
CTTTCGAGTGCAAAGAGTGTGGGAAAGCCTTTAGCAATCGGAAGGACCTCATTCGCCACTTCAGCATCCACACTGGAGAG
AAGCCCTATGAGTGCGTGGAGTGTGGAAAGGCCTTCACCCGCATGTCGGGCCTCACGAGGCACAAGCGGATTCATAGTGG
AGAGAAGCCCTATGAATGTGTTGAGTGTGGGAAATCGTTTTGCTGGAGCACAAACCTCATTCGACATGCCATTATCCACA
CTGGAGAGAAGCCCTATAAATGTAGTGAATGTGGAAAGGCCTTCAGTCGCAGCTCGTCCCTCACTCAGCATCAAAGGATG
CATACTGGGAAAAATCCCATCAGTGTAACAGATGTGGGAAGACCTTTTACAAGTGGACAAACCTCAGTTACCCTTCGAGA
ACTTCTTTTAGGGAAGGACTTTTTGAATGTAACCACTGAGGCAAATATTTTGCCAGAGGAAACATCTTCCTCTGCATCTG
ATCAACCATACCAAAGAGAAACCCCACAAGTGTCTTCACTG

Protein (627aa)

>JHU19786
MAAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLVSLGCPVPKAELICHLEHGQEPWTRKEDLS
QDTCPGDKGKPKTTEPTTCEPALSEGISLQGQVTQGNSVDSQLGQAEDQDGLSEMQEGHFRPGIDPQEKSPGKMSPECDG
LGTADGVCSRIGQEQVSPGDTVHSHNSCESGKDPMIQEEENNFKCSECGKVFNKKHLLAGHEKIHSGVKPYECTECGKTF
IKSTHLLQHHMIHTGERPYECMECGKAFNRKSYLTQHQRIHSGEKPYKCNECGKAFTHRSNFVLHNRRHTGEKSFVCTEC
GQVFRHRPGFLRHYVVHSGENPYECLECGKVFKHRSYLMWHQQTHTGEKPYECSECGKVFLESAALIHHYVIHTGEKPFE
CLECGKAFNHRSYLKRHQRIHTGEKPFVCSECGKAFTHCSTFILHKRAHTGEKPFECKECGKAFSNRKDLIRHFSIHTGE
KPYECVECGKAFTRMSGLTRHKRIHSGEKPYECVECGKSFCWSTNLIRHAIIHTGEKPYKCSECGKAFSRSSSLTQHQRM
HTGKNPISVTDVGRPFTSGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPYQRETPQVSSL