Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19768 RCOR1 KIAA0071;RCOR Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (1446bp)

>JHU19768
ATGGTGGAGAAGGGCCCCGAGGTCTCAGGGAAGCGGAGAGGGAGGAACAACGCGGCCGCCTCCGCCTCCGCCGCCGCCGC
CTCCGCCGCCGCCTCGGCCGCCTGCGCCTCGCCAGCCGCCACTGCCGCCTCGGGCGCCGCCGCCTCCTCAGCCTCGGCCG
CCGCCGCCTCAGCCGCCGCCGCCCCCAATAATGGCCAGAATAAAAGTTTGGCGGCGGCGGCGCCCAATGGCAACAGCAGC
AGCAACTCCTGGGAGGAAGGCAGCTCGGGCTCGTCCAGCGACGAGGAGCACGGTGGCGGTGGCATGAGGGTCGGACCCCA
GTACCAGGCGGTGGTGCCCGACTTCGACCCCGCCAAACTGGCAAGACGCAGTCAAGAACGGGACAATCTTGGCATGTTGG
TCTGGTCACCCAATCAAAATCTGTCAGAAGCAAAGTTGGATGAATACATTGCCATTGCCAAAGAAAAGCATGGGTACAAC
ATGGAACAGGCTCTTGGGATGCTCTTCTGGCATAAACATAATATCGAAAAGTCATTGGCTGATTTGCCCAACTTTACCCC
TTTCCCAGATGAGTGGACTGTGGAAGATAAAGTCTTATTTGAGCAAGCCTTTAGTTTTCATGGGAAAACTTTTCATAGAA
TCCAACAAATGCTTCCAGATAAATCTATAGCAAGTCTGGTGAAATTTTACTATTCTTGGAAGAAGACGAGGACTAAAACT
AGTGTGATGGATCGCCATGCCCGGAAACAAAAACGGGAGCGGGAGGAGAGCGAGGATGAACTGGAAGAGGCAAATGGAAA
CAATCCCATTGACATTGAGGTTGATCAAAACAAGGAAAGCAAAAAGGAGGTTCCCCCTACTGAGACAGTTCCTCAGGTCA
AAAAAGAAAAACATAGCACACAAGCTAAAAATAGAGCAAAAAGGAAACCTCCAAAAGGAATGTTTCTTTCTCAAGAAGAT
GTGGAGGCTGTTTCTGCCAATGCCACTGCTGCTACCACGGTGCTGAGACAACTAGACATGGAATTGGTTTCAGTCAAACG
ACAGATCCAGAATATTAAACAGACAAACAGTGCTCTCAAAGAAAAACTTGATGGTGGAATAGAACCATATCGACTTCCAG
AGGTCATTCAGAAATGTAATGCACGTTGGACTACAGAAGAGCAGCTTCTCGCCGTACAAGCCATCAGGAAATATGGCCGA
GATTTTCAGGCAATCTCAGACGTGATTGGGAACAAATCAGTGGTACAAGTGAAAAACTTTTTTGTAAATTATCGACGCCG
CTTCAACATAGATGAAGTTTTACAAGAATGGGAGGCAGAACATGGTAAAGAAGAGACCAATGGGCCCAGTAACCAGAAGC
CTGTGAAGTCCCCAGATAATTCCATTAAGATGCCCGAAGAGGAAGACGAGGCTCCTGTTCTGGATGTCAGATATGCATCT
GCCTCC

Protein (482aa)

>JHU19768
MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSS
SNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYN
MEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKT
SVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQED
VEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGR
DFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS
AS