Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19758 Nr1h4 Mus musculus No

HuProt v2.0
Block Row Column Clone
19 23 21 JHU19758
19 23 22 JHU19758
HuProt v3.0
Block Row Column Clone
19 31 4 JHU19758
19 32 4 JHU19758
HuProt v3.1
Block Row Column Clone
19 31 4 JHU19758
19 32 4 JHU19758

External Database ID

Nucleotide (1452bp)

>JHU19758
ATGGTGATGCAGTTTCAGGGTTTAGAAAATCCAATTCAGATTAGTCTTCACCACAGCCACCGGCTGTCAGGATTTGTGCC
GGACGGGATGAGTGTGAAGCCAGCTAAAGGTATGCTAACAGAACACGCGGCAGGCCCTCTGGGGCAGAATCTGGATTTGG
AATCGTACTCCCCATACAACAATGTCCCGTTTCCTCAAGTTCAGCCACAGATTTCCTCCTCGTCTTACTATTCCAACCTG
GGCTTCTACCCCCAACAACCGGAAGACTGGTATTCTCCTGGCATCTATGAACTCAGGCGAATGCCCGCTGAGACTGGGTA
CCAGGGAGAGACTGAGGTATCAGAGATGCCTGTGACAAAGAAGCCGCGAATGGCCGCGGCATCGGCAGGCAGAATAAAAG
GGGATGAGCTGTGTGTTGTCTGTGGAGACAGGGCCTCTGGGTACCACTACAACGCGCTCACCTGTGAGGGCTGCAAAGGT
TTCTTCCGAAGAAGCATTACCAAGAACGCCGTGTACAAGTGTAAGAACGGGGGCAACTGCGTGATGGACATGTACATGCG
CAGGAAGTGCCAGGAGTGCCGGCTAAGGAAGTGCAGAGAGATGGGGATGTTGGCTGAATGTTTGTTAACTGAAATCCAGT
GTAAATCTAAACGGCTAAGGAAAAATGTGAAGCAGCACGCTGATCAGACAGTGAATGAGGACGACAGCGAAGGGCGTGAC
TTGCGACAAGTGACCTCCACAACCAAGTTTTGCAGGGAGAAAACGGAACTCACGGCAGACCAGCAGACCCTCCTGGATTA
TATTATGGATTCGTACAACAAACAGAGAATGCCTCAGGAAATCACAAATAAAATCTTAAAAGAAGAATTTAGTGCAGAAG
AAAATTTTCTCATATTAACAGAAATGGCAACCAGTCATGTACAGATTCTCGTAGAATTCACAAAAAAGCTTCCAGGGTTT
CAGACACTGGACCACGAAGATCAGATTGCTTTGCTCAAAGGGTCCGCAGTGGAGGCCATGTTTCTTCGTTCGGCGGAGAT
TTTCAATAAGAAACTTCCTGCCGGACATGCAGACCTGTTGGAAGAAAGAATTCGAAAGAGTGGTATCTCTGATGAGTATA
TAACCCCGATGTTCAGTTTCTATAAAAGTGTTGGAGAACTCAAAATGACTCAGGAGGAGTACGCTCTGCTCACAGCGATC
GTCATCCTCTCTCCAGACAGACAATACATCAAGGACAGAGAGGCGGTGGAGAAGCTGCAGGAGCCCCTGCTTGATGTGCT
ACAAAAGCTGTGCAAGATGTACCAGCCTGAGAACCCACAGCATTTCGCCTGCCTCCTGGGTCGCCTGACGGAACTCCGGA
CATTCAACCATCACCACGCTGAGATGCTGATGTCTTGGAGAGTGAATGATCACAAGTTCACCCCGCTCCTCTGTGAGATC
TGGGATGTGCAG

Protein (484aa)

>JHU19758
MVMQFQGLENPIQISLHHSHRLSGFVPDGMSVKPAKGMLTEHAAGPLGQNLDLESYSPYNNVPFPQVQPQISSSSYYSNL
GFYPQQPEDWYSPGIYELRRMPAETGYQGETEVSEMPVTKKPRMAAASAGRIKGDELCVVCGDRASGYHYNALTCEGCKG
FFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECRLRKCREMGMLAECLLTEIQCKSKRLRKNVKQHADQTVNEDDSEGRD
LRQVTSTTKFCREKTELTADQQTLLDYIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATSHVQILVEFTKKLPGF
QTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPAGHADLLEERIRKSGISDEYITPMFSFYKSVGELKMTQEEYALLTAI
VILSPDRQYIKDREAVEKLQEPLLDVLQKLCKMYQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEI
WDVQ