Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19755 Q6p3f6 Homo sapiens No

HuProt v2.0
Block Row Column Clone
1 23 29 JHU19755
1 23 30 JHU19755
HuProt v3.0
Block Row Column Clone
17 31 1 JHU19755
17 32 1 JHU19755
HuProt v3.1
Block Row Column Clone
17 31 1 JHU19755
17 32 1 JHU19755

External Database ID

Nucleotide (1872bp)

>JHU19755
ATGGACGTCCCGGAGCCGCAGCCCGACCCCGATGGCGGGGACGGCCCCGGCCACGAGCCCGGGGGCAGTCCCCAAGACGA
GCTGGACTTTTCCATCCTCTTCGATTATGACTATCTGAACCCTATCGAAGAAGAACCGATCGCACATAAGGCCATCAGCT
CACCCTCCGGACTCGCATACCCGGATGATGTCCTGGACTATGGCCTCAAGCCATGCAACCCCCTTGCCAGTCTCTCTGGC
GAGCCCCCTGGCCGGTTCGGAGAGCCGGATAGTATAGGGTTCCAGAACTTTCTGAGCCCGGTCAAGCCAGCAGGGGCTTC
GGGCCCGAGCCCTCGGATCGAGATCACTCCATCCCACGAACTGATGCAGGCAGGGGGGGCCCTCCGTGGGAGAGACGCCG
GCCTGTCCCCCGAGCAGCCGGCCCTGGCCCTGGCCGGCGTGGCCGCCAGCCCGAGGTTCACACTGCCCGTGCCCGGCTAC
GAGGGCTACCGCGAGCCGCTTTGCTTGAGCCCCGCTAGCAGCGGCTCCTCTGCCAGCTTCATTTCTGACACCTTCTCCCC
CTACACCTCGCCCTGCGTCTCACCCAATAACGCCGGGCCCGACGACCTGTGTCCCCAGTTTCAAAACATCCCTGCTCATT
ATTCCCCCAGAACCTCTCCAATAATGTCACCTCGAACCAGCCTCGCCGAGGACAGCTGCCTGGGCCGACACTCGCCCGTG
CCCCGTCCGGCATCCCGCTCCTCCTCACCCGGTGCCAAGCGGAGGCATTCGTGCGCAGAGGCTTTGGTTGCTCCTCTGCC
CGCAGCCTCACCCCAGCGCTCCCGGAGCCCCTCGCCACAGCCCTCGCCTCACGTGGCACTGCAGGACGACAGCATCCCCG
CTGGGTACCCCCCCACGGCCGGCTCTGCTGTTCTCATGGATGCCCTCAACACCCTGGCCACCGACTCGCCCTGCGGGATC
CCCTCCAAGATATGGAAGACCAGTCCTGACCCGACGCCTGTGTCCACCGCTCCGTCCAAGGCTGGCCTGGCCCGCCACAT
CTACCCTACTGTGGAGTTCCTGGGGCCATGTGAGCAGGAGGAGAGGAGGAATTCCGCTCCAGAGTCCATCCTGCTGGTAC
CACCTACTTGGCCCAAGCAGTTGGTGCCGGCCATTCCCATCTGCAGCATCCCTGTGACTGCATCCCTCCCACCACTCGAG
TGGCCACTCTCCAATCAGTCGGGCTCCTATGAGCTACGGATTGAGGTCCAACCCAAGCCCCATCACCGGGCCCACTATGA
GACGGAGGGCAGCCGTGGCGCTGTCAAAGCCCCAACAGGAGGACACCCTGTGGTGCAGCTCCACGGCTACATGGAGAACA
AGCCTCTGGGGCTTCAGATCTTCATTGGGACAGCAGATGAGAGGATCCTTAAGCCGCACGCCTTCTACCAAGTACACAGG
ATCACTGGGAAAACGGTCACCACCACGAGCTATGAGAAGATCGTAGGCAACACCAAGGTCCTGGAGATCCCCCTGGAGCC
AAAGAACAACATGAGAGCCACCATCGACTGTGCAGGCATCCTGAAGCTCCGAAACGCTGACATCGAGCTGCGGAAGGGCG
AGACGGACATCGGCAGGAAGAACACGCGTGTGCGCCTGGTGTTCCGCGTGCACGTCCCAGAGCCCAGTGGGCGCATCGTC
TCCCTGCAGGCTGCGTCCAACCCCATCGAGTGCTGTAAGTCAGGGCTGAGGAAGGGGCATGTGAGCATCCCCCCTGGGCA
GGTGACCTGCAGGAATCCACCGGTCTGTGGTGACCCAAAGGGCAGACACTGTGCCCAGGTTTTGATGTCTGCTTCTGTCT
GCTTGTGGAGACTTCTCTCAGGAAATAAAACA

Protein (624aa)

>JHU19755
MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHKAISSPSGLAYPDDVLDYGLKPCNPLASLSG
EPPGRFGEPDSIGFQNFLSPVKPAGASGPSPRIEITPSHELMQAGGALRGRDAGLSPEQPALALAGVAASPRFTLPVPGY
EGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNAGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPV
PRPASRSSSPGAKRRHSCAEALVAPLPAASPQRSRSPSPQPSPHVALQDDSIPAGYPPTAGSAVLMDALNTLATDSPCGI
PSKIWKTSPDPTPVSTAPSKAGLARHIYPTVEFLGPCEQEERRNSAPESILLVPPTWPKQLVPAIPICSIPVTASLPPLE
WPLSNQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHR
ITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHVPEPSGRIV
SLQAASNPIECCKSGLRKGHVSIPPGQVTCRNPPVCGDPKGRHCAQVLMSASVCLWRLLSGNKT