Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19749 SMAD9 MADH6;MADH9 Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (1401bp)

>JHU19749
ATGCACTCCACCACCCCCATCAGCTCCCTCTTCTCCTTCACCAGCCCCGCAGTGAAGAGACTGCTAGGCTGGAAGCAAGG
AGATGAAGAGGAAAAGTGGGCAGAGAAGGCAGTGGACTCTCTAGTGAAGAAGTTAAAGAAGAAGAAGGGAGCCATGGACG
AGCTGGAGAGGGCTCTCAGCTGCCCGGGGCAGCCCAGCAAATGCGTCACGATTCCCCGCTCCCTGGACGGGCGGCTGCAG
GTGTCCCACCGCAAGGGCCTGCCCCATGTGATTTACTGTCGCGTGTGGCGCTGGCCGGATCTGCAGTCCCACCACGAGCT
GAAGCCGCTGGAGTGCTGTGAGTTCCCATTTGGCTCCAAGCAGAAAGAAGTGTGCATTAACCCTTACCACTACCGCCGGG
TGGAGACTCCAGTACTGCCTCCTGTGCTCGTGCCAAGACACAGTGAATATAACCCCCAGCTCAGCCTCCTGGCCAAGTTC
CGCAGCGCCTCCCTGCACAGTGAGCCACTCATGCCACACAACGCCACCTATCCTGACTCTTTCCAGCAGCCTCCGTGCTC
TGCACTCCCTCCCTCACCCAGCCACGCGTTCTCCCAGTCCCCGTGCACGGCCAGCTACCCTCACTCCCCAGGAAGTCCTT
CTGAGCCAGAGAGTCCCTATCAACACTCAGTTGACACACCACCCCTGCCTTATCATGCCACAGAAGCCTCTGAGACCCAG
AGTGGCCAACCTGTAGATGCCACAGCTGATAGACACGTAGTGCTATCGATACCAAATGGAGACTTTCGACCAGTTTGTTA
CGAGGAGCCCCAGCACTGGTGCTCGGTCGCCTACTATGAACTGAACAACCGAGTTGGGGAGACATTCCAGGCTTCCTCCC
GAAGTGTGCTCATAGATGGGTTCACCGACCCTTCAAATAACAGGAACAGATTCTGTCTTGGACTTCTTTCTAATGTAAAC
AGAAACTCAACGATAGAAAATACCAGGAGACATATAGGAAAGGGTGTGCACTTGTACTACGTCGGGGGAGAGGTGTATGC
CGAGTGCGTGAGTGACAGCAGCATCTTTGTGCAGAGCCGGAACTGCAACTATCAACACGGCTTCCACCCAGCTACCGTCT
GCAAGATCCCCAGCGGCTGCAGCCTCAAGGTCTTCAACAACCAGCTCTTCGCTCAGCTCCTGGCCCAGTCAGTTCACCAC
GGCTTTGAAGTCGTGTATGAACTGACCAAGATGTGTACTATCCGGATGAGTTTTGTTAAGGGTTGGGGTGCTGAGTATCA
TCGCCAGGATGTCACCAGCACCCCCTGCTGGATTGAGATTCATCTTCATGGGCCACTGCAGTGGCTGGACAAAGTTCTGA
CTCAGATGGGCTCTCCACATAACCCCATTTCTTCAGTGTCT

Protein (467aa)

>JHU19749
MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVTIPRSLDGRLQ
VSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKF
RSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSVDTPPLPYHATEASETQ
SGQPVDATADRHVVLSIPNGDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVN
RNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHH
GFEVVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS