Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19739 CDR2L HUMPPA Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (1377bp)

>JHU19739
ATGGAGGACTTCTCCGCGGAGGAAGAGGAGTCCTGGTACGACCAGCAGGACCTGGAGCAGGACTTGCACCTAGCTGCGGA
GCTGGGGAAGACTCTGCTGGAGAGGAACAAGGAGCTGGAGGGGTCCCTGCAGCAGATGTACTCCACCAATGAGGAACAGG
TGCAGGAGATCGAGTACCTAACCAAGCAGCTGGACACGCTGCGGCACGTGAACGAGCAGCACGCCAAAGTCTATGAGCAG
CTGGACCTGACAGCCCGGGACCTGGAGCTGACCAACCACAGGCTGGTGCTGGAGAGTAAGGCTGCCCAGCAGAAGATCCA
TGGGCTGACGGAGACCATTGAGCGCCTCCAGGCTCAGGTGGAGGAGCTGCAGGCCCAGGTGGAGCAACTGAGAGGCCTGG
AACAGCTGCGAGTGCTCCGGGAGAAGCGGGAACGCAGGCGTACCATCCACACCTTCCCCTGCCTCAAGGAGCTGTGCACC
AGCCCCCGGTGCAAGGATGCTTTCCGCCTACACAGTTCCTCCCTGGAGCTGGGCCCGCGGCCCCTGGAGCAGGAGAACGA
GCGGCTGCAGACCCTGGTGGGGGCGCTGCGCTCCCAGGTGAGCCAGGAGCGGCAGCGCAAGGAGCGGGCGGAGCGCGAGT
ACACCGCGGTGCTGCAGGAGTACTCGGAGCTGGAGCGCCAGCTGTGCGAGATGGAGGCCTGTCGCCTGCGTGTGCAGGAG
CTGGAGGCCGAGCTGCTGGAGCTGCAGCAGATGAAGCAGGCCAAGACCTACCTACTGGGTCCGGACGACCACCTGGCCGA
GGCCCTGCTCGCACCCCTCACGCAGGCCCCTGAGGCCGACGATCCCCAGCCCGGCCGCGGGGACGACTTGGGCGCCCAGG
ACGGGGTCTCCTCACCGGCAGCCTCTCCAGGCCACGTGGTGCGCAAGAGCTGCAGCGACACTGCGCTCAACGCCATCGTG
GCCAAAGACCCAGCCAGCCGGCACGCGGGCAACCTCACACTGCACGCCAACAGCGTGCGCAAGCGGGGCATGTCCATCCT
GCGGGAGGTGGACGAGCAGTACCACGCGCTGCTGGAGAAGTACGAGGAGCTGCTGAGCAAGTGCCGGCAGCACGGGGCCG
GAGTGCGGCACGCCGGCGTGCAGACCTCGCGCCCCATCTCCCGGGACAGCTCGTGGAGGGACCTGCGCGGGGGTGAGGAG
GGCCAGGGTGAGGTCAAGGCAGGAGAGAAGAGCCTGAGCCAGCACGTGGAGGCCGTGGACAAGCGGCTGGAACAGAGCCA
GCCCGAGTACAAGGCGCTCTTCAAAGAGATCTTCTCCAGGATCCAGAAGACCAAGGCTGACATCAACGCCACCAAAGTCA
AGACGCACAGCAGCAAG

Protein (459aa)

>JHU19739
MEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQVQEIEYLTKQLDTLRHVNEQHAKVYEQ
LDLTARDLELTNHRLVLESKAAQQKIHGLTETIERLQAQVEELQAQVEQLRGLEQLRVLREKRERRRTIHTFPCLKELCT
SPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQERQRKERAEREYTAVLQEYSELERQLCEMEACRLRVQE
LEAELLELQQMKQAKTYLLGPDDHLAEALLAPLTQAPEADDPQPGRGDDLGAQDGVSSPAASPGHVVRKSCSDTALNAIV
AKDPASRHAGNLTLHANSVRKRGMSILREVDEQYHALLEKYEELLSKCRQHGAGVRHAGVQTSRPISRDSSWRDLRGGEE
GQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSSK