Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19733 GCM2 GCMB Homo sapiens No Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
17 23 21 JHU19733
17 23 22 JHU19733
HuProt v3.0
Block Row Column Clone
19 31 19 JHU19733
19 32 19 JHU19733
HuProt v3.1
Block Row Column Clone
19 31 19 JHU19733
19 32 19 JHU19733

External Database ID

Nucleotide (1518bp)

>JHU19733
ATGCCGGCGGCCGCGGTGCAGGAAGCGGTCGGCGTGTGCTCCTACGGGATGCAGCTCAGCTGGGACATCAACGATCCGCA
GATGCCTCAGGAGCTGGCCCTCTTTGACCAATTCCGAGAGTGGCCTGACGGCTATGTGCGCTTCATCTACAGCAGCGATG
AGAAGAAGGCACAGCGTCACCTGAGCGGCTGGGCCATGCGCAACACCAACAACCACAATGGCCACATCCTCAAGAAGTCG
TGCCTGGGTGTGGTGGTGTGTACACAGGCCTGCACCCTGCCCGACGGTTCCCGCCTGCAGCTGAGGCCGGCCATCTGCGA
CAAGGCACGGCTGAAACAGCAGAAGAAGGCATGCCCTAACTGTCATTCTGCTTTGGAGTTGATTCCTTGTCGAGGGCACA
GCGGATACCCCGTAACCAACTTTTGGCGGCTTGATGGCAACGCGATCTTTTTTCAGGCCAAGGGAGTTCATGATCATCCA
AGACCAGAGAGCAAATCAGAGACAGAAGCTAGAAGAAGCGCCATCAAGAGACAAATGGCCTCTTTCTACCAACCCCAGAA
AAAGAGAATTCGAGAATCCGAGGCAGAAGAAAATCAAGACAGCAGTGGTCATTTCAGCAACATACCTCCCTTGGAAAATC
CAGAAGACTTTGATATAGTTACTGAAACCAGCTTCCCTATTCCAGGGCAGCCTTGCCCTTCCTTCCCAAAGTCTGATGTT
TACAAAGCTACCTGTGACCTAGCCACCTTTCAAGGAGACAAAATGCCACCCTTCCAGAAATACTCAAGCCCAAGAATCTA
TTTGCCTAGGCCACCTTGCAGCTATGAATTGGCAAACCCTGGTTATACAAATTCAAGCCCATATCCCACCCTTTATAAGG
ATTCCACCAGTATCCCTAATGACACAGACTGGGTTCATCTGAACACACTACAATGTAATGTCAATTCATACAGCAGCTAT
GAGAGAAGCTTTGATTTCACCAACAAACAGCATGGCTGGAAACCAGCTCTTGGAAAACCCAGCCTTGTGGAAAGGACTAA
CCATGGGCAGTTTCAGGCCATGGCCACTCGCCCTTATTATAACCCAGAGCTTCCCTGCAGGTACCTCACGACTCCACCAC
CAGGTGCCCCTGCCCTACAAACCGTGATCACCACCACCACTAAAGTGTCCTACCAGGCCTACCAGCCCCCTGCTATGAAA
TACAGTGACAGTGTGCGAGAGGTGAAGAGCCTTTCGAGCTGTAACTATGCTCCTGAAGATACTGGGATGTCTGTCTATCC
AGAACCCTGGGGTCCTCCGGTGACAGTCACCAGGGCAGCCTCTCCTTCAGGGCCACCTCCTATGAAAATTGCAGGAGATT
GCCGGGCCATCAGACCCACTGTGGCTATTCCCCACGAGCCAGTTTCCTCTAGGACAGATGAAGCAGAGACTTGGGATGTG
TGTCTGTCTGGGCTGGGCTCCGCAGTCAGTTACTCAGACAGAGTGGGTCCCTTCTTTACCTACAACAATGAGGATTTT

Protein (506aa)

>JHU19733
MPAAAVQEAVGVCSYGMQLSWDINDPQMPQELALFDQFREWPDGYVRFIYSSDEKKAQRHLSGWAMRNTNNHNGHILKKS
CLGVVVCTQACTLPDGSRLQLRPAICDKARLKQQKKACPNCHSALELIPCRGHSGYPVTNFWRLDGNAIFFQAKGVHDHP
RPESKSETEARRSAIKRQMASFYQPQKKRIRESEAEENQDSSGHFSNIPPLENPEDFDIVTETSFPIPGQPCPSFPKSDV
YKATCDLATFQGDKMPPFQKYSSPRIYLPRPPCSYELANPGYTNSSPYPTLYKDSTSIPNDTDWVHLNTLQCNVNSYSSY
ERSFDFTNKQHGWKPALGKPSLVERTNHGQFQAMATRPYYNPELPCRYLTTPPPGAPALQTVITTTTKVSYQAYQPPAMK
YSDSVREVKSLSSCNYAPEDTGMSVYPEPWGPPVTVTRAASPSGPPPMKIAGDCRAIRPTVAIPHEPVSSRTDEAETWDV
CLSGLGSAVSYSDRVGPFFTYNNEDF