Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19732 GCM1 GCMA Homo sapiens No Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
27 23 17 JHU19732
27 23 18 JHU19732
HuProt v3.0
Block Row Column Clone
20 31 24 JHU19732
20 32 24 JHU19732
HuProt v3.1
Block Row Column Clone
20 31 24 JHU19732
20 32 24 JHU19732

External Database ID

Nucleotide (1308bp)

>JHU19732
ATGGAACCTGACGACTTTGATTCTGAAGACAAAGAGATATTAAGCTGGGATATTAATGATGTGAAACTGCCACAGAACGT
GAAAAAAACCGACTGGTTCCAGGAGTGGCCAGATTCCTATGCCAAACACATCTACAGCTCGGAGGACAAGAATGCGCAGC
GGCACCTGAGCAGCTGGGCCATGCGCAATACCAACAACCACAACTCCCGCATCCTCAAGAAGTCCTGCCTGGGTGTGGTG
GTGTGCGGCCGCGACTGTCTCGCAGAGGAGGGGCGCAAGATCTACCTGAGACCTGCCATCTGTGACAAGGCCCGGCAGAA
GCAGCAGCGGAAACGCTGTCCCAACTGTGACGGGCCTCTGAAGCTCATCCCTTGCCGAGGTCATGGGGGCTTCCCGGTCA
CCAACTTCTGGAGGCACGACGGACGCTTTATATTTTTCCAGTCAAAGGGAGAGCATGATCATCCAAAACCAGAAACCAAG
TTAGAAGCTGAGGCAAGAAGAGCCATGAAGAAAGTGAACACAGCACCTTCCTCCGTCTCATTGAGCCTGAAGGGGAGCAC
AGAGACCAGGTCTCTTCCAGGTGAAACACAAAGTCAGGGGAGTTTACCTTTAACTTGGTCTTTCCAGGAAGGCGTCCAAT
TGCCTGGTAGTTACAGTGGACATTTAATAGCTAACACTCCTCAGCAGAACTCACTAAATGATTGCTTTTCCTTCTCCAAG
AGTTATGGTCTGGGAGGAATCACAGATCTGACTGACCAGACTTCCACTGTGGACCCCATGAAGCTCTATGAAAAGCGCAA
ATTGTCCAGTAGCAGAACCTACAGTAGTGGAGACCTGCTTCCTCCTTCTGCCTCCGGAGTCTACTCTGATCATGGCGATC
TACAAGCGTGGAGTAAAAATGCTGCTTTGGGGAGAAATCATCTTGCTGACAACTGTTATTCCAATTATCCTTTTCCTCTG
ACCAGCTGGCCTTGCAGCTTCTCTCCTTCCCAAAACTCTTCAGAACCCTTTTACCAGCAGCTTCCATTGGAGCCACCTGC
AGCCAAAACTGGCTGTCCCCCATTATGGCCAAATCCAGCGGGTAATCTTTATGAAGAGAAAGTACATGTGGATTTTAACA
GCTACGTCCAGTCTCCTGCATACCATTCACCTCAAGAAGACCCCTTTCTCTTCACCTACGCCTCTCATCCTCATCAGCAA
TATTCACTGCCAAGCAAGAGCAGCAAATGGGATTTTGAGGAAGAAATGACATACTTGGGTTTGGATCACTGCAACAATGA
TATGCTTCTGAACCTGTGTCCTTTGAGA

Protein (436aa)

>JHU19732
MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSRILKKSCLGVV
VCGRDCLAEEGRKIYLRPAICDKARQKQQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETK
LEAEARRAMKKVNTAPSSVSLSLKGSTETRSLPGETQSQGSLPLTWSFQEGVQLPGSYSGHLIANTPQQNSLNDCFSFSK
SYGLGGITDLTDQTSTVDPMKLYEKRKLSSSRTYSSGDLLPPSASGVYSDHGDLQAWSKNAALGRNHLADNCYSNYPFPL
TSWPCSFSPSQNSSEPFYQQLPLEPPAAKTGCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQ
YSLPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCPLR