Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19726 ZNF419 ZNF419A Homo sapiens No Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
25 23 21 JHU19726
25 23 22 JHU19726
HuProt v3.0
Block Row Column Clone
19 31 25 JHU19726
19 32 25 JHU19726
HuProt v3.1
Block Row Column Clone
19 31 25 JHU19726
19 32 25 JHU19726

External Database ID

Nucleotide (1530bp)

>JHU19726
ATGGCGGCGGCCGCCCTGAGGGACCCCGCTCAGGTTCCTGTGGCTGCAGACTTGCTTACAGACCATGAGGAGGGCTATGT
GACCTTTGAGGATGTGGCTGTCTACTTCTCCCAGGAGGAATGGAGATTGCTTGATGACGCTCAGAGGCTCCTCTACCGCA
ATGTGATGCTGGAGAACTTTACACTTCTGGCCTCTCTCGGACTTGCATCTTCCAAGACCCATGAAATAACCCAGCTGGAG
TCATGGGAGGAGCCCTTCATGCCTGCTTGGGAAGTTGTGACTTCAGCCATACCGAGAGGTTGTTGGCATGGAGCCGAGGC
TGAGGAGGCTCCTGAGCAGATTGCTTCTGTAGGACTGCTCAGTTCAAACATTCAGCAACACCAGAAGCAGCACTGTGGAG
AGAAACCCTTAAAAAGACAACAGGGCAGGGTCCCAGTTTTGAGGAGTTGCAAAGTTCACCTATCAGAGAAGTCCTTGCAA
AGCAGGGAGGTTGGGAAGGCCCTCCTGATCAGCTCAGGTGTTCTCAAGCACCAGGTGACTCACACAGGAGAGAAGTCACA
TAGGAGCTCCAAAAGTAGGGAGGCCTTTCATGCTGGAAAAAGGCATTACAAATGCAGTGAATGTGGGAAAGCCTTTGGTC
AGAAATATTTACTTGTTCAGCACCAGAGACTACATGCTGGGAAAAAGACGTATGAATGCAGTGAATGTGGGAAGTTATTT
AGAGATATGTCCAACCTTTTTATACACCAAATAGTTCACACTGGAGAAAGGCCTTACGGGTGTAGTAACTGTGGAAAATC
CTTTAGCCGTAATGCTCACCTCATTGAACACCAGAGAGTTCACACTGGAGAAAAGCCTTTTACATGCAGTGAATGTGGAA
AAGCTTTCAGGCATAATTCCACACTTGTTCAGCATCACAAAATCCACACTGGAGTAAGGCCTTATGAGTGCAGTGAATGT
GGAAAATTGTTTAGTTTCAACTCCAGCCTCATGAAACATCAGAGAGTTCACACTGGAGAAAGACCTTATAAGTGCAGTGA
ATGTGGAAAATTCTATAGCCACAAGTCCAACCTTATCAAACATTGGCGTGTTCATACTGGAGAAAGGCCTTACAAGTGCA
GCGACTGTGGGAAATTTTTTACCCAATGCTCAAGCCTCATGCAACATCAAAAAGTTCACACTGGAGAAAAGCCTTTTAAG
TGCAATGAATGTGGGAGATTCTTTAGAGAGAATTCCACCCTAGTTAGACATCAGAGGGTTCACACTGGAGCAAAGCCTTA
TGAGTGCAGGGAATGTGGGAAATTTTTTAGCCAAAGCTCAACCCTCATGCAACATCGAAAAGTTCACATTGGAGAAAAGC
CTTTTAAGTGCAATGAATGTGGGAGATTGTTTAGAGAGAATTCCAGCCTTGTTAAACATCAGAGGGTTCACACTGGAGCA
AAGCCTTATGAGTGCAGGGAATGTGGGAAGTTTTTTCGCCACAACTCCAGTCTTTTTAAACATCGAAGGATTCACACTGG
AGAAATGCAG

Protein (510aa)

>JHU19726
MAAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEEWRLLDDAQRLLYRNVMLENFTLLASLGLASSKTHEITQLE
SWEEPFMPAWEVVTSAIPRGCWHGAEAEEAPEQIASVGLLSSNIQQHQKQHCGEKPLKRQQGRVPVLRSCKVHLSEKSLQ
SREVGKALLISSGVLKHQVTHTGEKSHRSSKSREAFHAGKRHYKCSECGKAFGQKYLLVQHQRLHAGKKTYECSECGKLF
RDMSNLFIHQIVHTGERPYGCSNCGKSFSRNAHLIEHQRVHTGEKPFTCSECGKAFRHNSTLVQHHKIHTGVRPYECSEC
GKLFSFNSSLMKHQRVHTGERPYKCSECGKFYSHKSNLIKHWRVHTGERPYKCSDCGKFFTQCSSLMQHQKVHTGEKPFK
CNECGRFFRENSTLVRHQRVHTGAKPYECRECGKFFSQSSTLMQHRKVHIGEKPFKCNECGRLFRENSSLVKHQRVHTGA
KPYECRECGKFFRHNSSLFKHRRIHTGEMQ