Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19704 NACC1 BTBD14B;NAC1 Homo sapiens No Nuclear Proteins

HuProt v2.0
Block Row Column Clone
3 23 25 JHU19704
3 23 26 JHU19704
HuProt v3.0
Block Row Column Clone
18 31 6 JHU19704
18 32 6 JHU19704
HuProt v3.1
Block Row Column Clone
18 31 6 JHU19704
18 32 6 JHU19704

External Database ID

Nucleotide (1581bp)

>JHU19704
ATGGCCCAGACACTGCAGATGGAGATCCCGAACTTCGGCAACAGCATCCTGGAGTGCCTCAATGAACAGCGGCTGCAGGG
CCTGTACTGTGACGTGTCAGTGGTGGTCAAGGGCCATGCCTTCAAGGCCCACCGGGCCGTGCTTGCTGCCAGCAGCTCCT
ACTTCCGGGACCTGTTCAACAACAGCCGCAGCGCCGTGGTGGAGCTGCCGGCGGCTGTGCAGCCCCAGTCTTTCCAGCAG
ATCCTCAGCTTCTGCTACACGGGCCGGCTGAGCATGAACGTGGGCGACCAGTTCCTGCTCATGTACACGGCTGGCTTCCT
GCAGATCCAGGAGATCATGGAGAAGGGCACCGAGTTCTTCCTCAAGGTGAGCTCCCCGAGCTGCGACTCCCAGGGCCTGC
ATGCGGAGGAGGCCCCATCGTCGGAGCCCCAGAGCCCCGTGGCGCAGACATCGGGCTGGCCAGCCTGTAGCACCCCGCTG
CCCCTCGTGTCGCGGGTGAAGACGGAGCAGCAGGAGTCGGACTCCGTGCAGTGCATGCCCGTGGCCAAGCGGCTGTGGGA
CAGTGGCCAGAAGGAGGCTGGGGGCGGCGGCAATGGCAGCCGCAAGATGGCCAAGTTCTCCACGCCGGACCTGGCTGCCA
ACCGGCCTCACCAGCCCCCGCCACCCCAACAGGCTCCGGTGGTGGCAGCAGCCCAGCCCGCCGTGGCTGCGGGAGCAGGG
CAGCCAGCCGGTGGGGTGGCAGCAGCAGGGGGTGTGGTGAGTGGGCCCAGCACGTCGGAGCGGACCAGCCCAGGCACCTC
AAGCGCCTACACCAGCGACAGCCCTGGCTCCTACCACAATGAGGAGGACGAGGAGGAGGATGGTGGCGAGGAGGGCATGG
ATGAGCAGTACCGGCAGATCTGCAACATGTACACCATGTACAGCATGATGAACGTCGGCCAGACAGCCGAGAAGGTGGAG
GCCCTCCCGGAGCAGGTAGCCCCCGAGTCCCGAAATCGCATCCGGGTTCGGCAAGACCTGGCGTCTCTCCCGGCTGAACT
TATCAACCAGATTGGGAACCGCTGCCACCCCAAGCTCTACGACGAGGGCGACCCCTCTGAGAAGCTGGAGCTGGTGACAG
GCACCAACGTGTACATCACAAGGGCGCAGCTGATGAACTGCCACGTCAGCGCAGGCACGCGGCACAAGGTCCTACTGCGG
CGGCTCCTGGCCTCCTTCTTTGACCGGAACACGCTGGCCAACAGCTGCGGCACCGGCATCCGCTCTTCTACCAACGATCC
CCGTCGGAAGCCCCTGGACAGCCGCGTGCTCCACGCTGTCAAGTACTACTGCCAGAACTTCGCCCCCAACTTCAAGGAGA
GCGAGATGAATGCCATCGCGGCCGACATGTGCACCAACGCCCGCCGCGTCGTGCGCAAGAGCTGGATGCCCAAGGTCAAG
GTGCTCAAGGCTGAGGATGACGCCTACACCACCTTCATCAGTGAAACGGGCAAGATCGAGCCGGACATGATGGGTGTGGA
GCATGGCTTCGAGACCGCCAGCCACGAGGGCGAGGCGGGTCCCTCGGCTGAAGCCCTGCAG

Protein (527aa)

>JHU19704
MAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNNSRSAVVELPAAVQPQSFQQ
ILSFCYTGRLSMNVGDQFLLMYTAGFLQIQEIMEKGTEFFLKVSSPSCDSQGLHAEEAPSSEPQSPVAQTSGWPACSTPL
PLVSRVKTEQQESDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAG
QPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVE
ALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLR
RLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVK
VLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ