Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19695 Zar1 Mus musculus No

HuProt v2.0
Block Row Column Clone
24 23 25 JHU19695
24 23 26 JHU19695
22 23 25 JHU19695
22 23 26 JHU19695
HuProt v3.0
Block Row Column Clone
18 31 22 JHU19695
18 32 22 JHU19695
18 31 17 JHU19695
18 32 17 JHU19695
HuProt v3.1
Block Row Column Clone
18 31 22 JHU19695
18 32 22 JHU19695
18 31 17 JHU19695
18 32 17 JHU19695

External Database ID

Nucleotide (1083bp)

>JHU19695
ATGTTCCCGGCGAGCACGTTCCACCCCTGCCCGCATCCTTATCCGCAGGCCACCAAAGCCGGGGATGGCTGGAGGTTCGG
AGCCAGGGGCTGCCGACCCGCGCCCCCCTCCTTCCTCCCCGGCTACAGACAGCTCATGGCCGCGGAGTACGTCGACAGCC
ACCAGCGGGCACAGCTCATGGCCCTGCTGTCGCGGATGGGTCCCCGGTCGGTCAGCAGCCGTGACGCTGCGGTGCAGGTG
AACCCGCGCCGCGACGCCTCGGTGCAGTGTTCACTCGGGCGCCGCACGCTGCAGCCTGCAGGGTGTCGAGCCAGCCCCGA
CGCCCGATCGGGTTCCTGTCAACCCCGTGGCCACGCCGGCGCCGGGAGATCCCCGCGATCCTGGCAGACCGTAGCCCCGT
TCTCGTCCGTGACCTTCTGTGGCCTCTCCTCCTCACTGGAGGTTGCGGGAGGCAGGCAGACACCCACGAAGGGAGAGGGG
AGCCCGGCATCCTCGGGGACCCGGGAACCGGAGCCGAGAGAGGTGGCCGCGAGGAAAGCGGTCCCCCAGCCGCGAAGCGA
GGAGGGCGATGTTCAGGCTGCAGGGCAGGCCGGGTGGGAGCAGCAGCCACCACCGGAGGACCGGAACAGTGTGGCGGCGA
TGCAGTCTGAGCCTGGGAGCGAGGAGCCATGTCCTGCCGCAGAGATGGCTCAGGACCCCGGTGATTCGGATGCCCCTCGA
GACCAGGCCTCCCCGCAAAGCACGGAGCAGGACAAGGAGCGCCTGCGTTTCCAGTTCTTAGAGCAGAAGTACGGCTACTA
TCACTGCAAGGACTGCAAAATCCGGTGGGAGAGCGCCTATGTGTGGTGTGTGCAGGGCACCAGTAAGGTGTACTTCAAAC
AGTTCTGCCGAGTGTGTGAGAAATCCTACAACCCTTACAGAGTGGAGGACATCACCTGTCAAAGTTGTAAAAGAACTAGA
TGTGCCTGCCCAGTCAGACTTCGCCACGTGGACCCTAAACGCCCCCATCGGCAAGACTTGTGTGGGAGATGCAAGGACAA
ACGCCTGTCCTGCGACAGCACCTTCAGCTTCAAATACATCATT

Protein (361aa)

>JHU19695
MFPASTFHPCPHPYPQATKAGDGWRFGARGCRPAPPSFLPGYRQLMAAEYVDSHQRAQLMALLSRMGPRSVSSRDAAVQV
NPRRDASVQCSLGRRTLQPAGCRASPDARSGSCQPRGHAGAGRSPRSWQTVAPFSSVTFCGLSSSLEVAGGRQTPTKGEG
SPASSGTREPEPREVAARKAVPQPRSEEGDVQAAGQAGWEQQPPPEDRNSVAAMQSEPGSEEPCPAAEMAQDPGDSDAPR
DQASPQSTEQDKERLRFQFLEQKYGYYHCKDCKIRWESAYVWCVQGTSKVYFKQFCRVCEKSYNPYRVEDITCQSCKRTR
CACPVRLRHVDPKRPHRQDLCGRCKDKRLSCDSTFSFKYII