Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19678 Prdm9_frag Mus musculus No

HuProt v2.0
Block Row Column Clone
22 23 17 JHU19678
22 23 18 JHU19678
HuProt v3.0
Block Row Column Clone
20 31 17 JHU19678
20 32 17 JHU19678
HuProt v3.1
Block Row Column Clone
20 31 17 JHU19678
20 32 17 JHU19678

Nucleotide (675bp)

>JHU19678
ATGTACAGGCTGCGAGAGAGAAAGGGCCTTGCCTATGAGGAGGTCAGCGAGCCTCAGGATGATGACTATCTCTATTGTGA
GAAGTGCCAGAATTTCTTCATCGACAGTTGTCCCAACCATGGGCCTCCTTTATTTGTAAAAGACAGTATGGTGGACAGGG
GGCATCCCAACCACTCAGTCCTCAGTCTGCCCCCTGGGCTAAGAATTAGTCCATCGGGCATCCCTGAAGCTGGACTTGGA
GTATGGAATGAAGCATCTGATCTACCAGTCGGTCTGCACTTTGGCCCCTATGAGGGTCAGATCACAGAGGATGAAGAGGC
AGCCAACAGTGGTTACTCCTGGCTGATTACCAAGGGAAGAAACTGCTATGAGTATGTGGATGGACAGGACGAGTCCCAAG
CCAACTGGATGAGGTATGTGAACTGTGCCCGGGATGATGAAGAGCAGAACCTGGTAGCCTTTCAATATCACAGGAAAATC
TTCTATCGAACCTGCCGGGTTATCAGACCAGGTTGTGAGCTTCTGGTCTGGTATGGGGATGAGTACGGCCAGGAACTGGG
CATTAAGTGGGGAAGCAAGATGAAGAAAGGATTCACAGCAGGAAGAGGTGGGCACTATTATGATTCCTTAAAAAAGAAAG
AGAAGAGGGAATTCTCCTTGAGAATTTTCATTTTC

Protein (225aa)

>JHU19678
MYRLRERKGLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLG
VWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKI
FYRTCRVIRPGCELLVWYGDEYGQELGIKWGSKMKKGFTAGRGGHYYDSLKKKEKREFSLRIFIF