Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19666 NHLH2 BHLHA34;HEN2;KIAA0490 Homo sapiens No Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
16 23 17 JHU19666
16 23 18 JHU19666
HuProt v3.0
Block Row Column Clone
20 31 14 JHU19666
20 32 14 JHU19666
HuProt v3.1
Block Row Column Clone
20 31 14 JHU19666
20 32 14 JHU19666

External Database ID

Nucleotide (405bp)

>JHU19666
ATGATGCTGAGTCCGGACCAAGCAGCAGATTCGGACCATCCCAGCTCGGCGCACTCGGATCCGGAGTCCCTGGGCGGCAC
GGACACCAAGGTGCTCGGCAGCGTGTCGGACCTGGAGCCGGTGGAGGAGGCCGAGGGCGACGGCAAGGGCGGCAGCCGAG
CCGCGCTCTACCCGCACCCGCAGCAGCTGAGCCGCGAGGAGAAGCGCCGCCGCCGGCGCGCCACGGCCAAGTACCGCTCG
GCCCACGCCACCCGCGAGCGCATCCGCGTGGAAGCCTTCAACTTGGCCTTCGCCGAGCTCCGCAAATTGCTGCCCACGCT
GCCCCCGGACAAGAAGCTCTCCAAGATCGAGATCCTGCGCCTGGCCATCTGCTACATCTCCTATCTCAACCACGTCCTGG
ACGTG

Protein (135aa)

>JHU19666
MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRS
AHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV